DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10694 and AT4G05240

DIOPT Version :9

Sequence 1:NP_651212.1 Gene:CG10694 / 42855 FlyBaseID:FBgn0039147 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_192433.1 Gene:AT4G05240 / 825872 AraportID:AT4G05240 Length:197 Species:Arabidopsis thaliana


Alignment Length:92 Identity:14/92 - (15%)
Similarity:40/92 - (43%) Gaps:5/92 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LEMNESQEVRALKQKLGNLPEVAMPAENLQLIYSGRIMEDAMPLSEYRIAEDKIIVLMGKKKVDK 79
            :|:.....|..:|||:.....:.:..:.  |.:.|.:::|.:.:.:..|....::.:......:.
plant    72 IELGYWDTVLEIKQKIEKYQRILVYRQT--LFFQGNVLQDHLDIEQCVILNHSLLKVFVDPYRNP 134

  Fly    80 SSPEEKVAPT---PPLAAGPNVLRTED 103
            :...:::..|   |||.:...::..:|
plant   135 NHDNDQMLQTEESPPLNSAKEIVNVQD 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10694NP_651212.1 rad23 1..284 CDD:273167 14/92 (15%)
UBQ 1..76 CDD:294102 9/60 (15%)
UBA1_Rad23_like 110..148 CDD:270466
XPC-binding 172..227 CDD:286376
UBA2_Rad23_like 245..282 CDD:270467
AT4G05240NP_192433.1 Ubiquitin_like_fold 65..130 CDD:391949 9/59 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.