DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10694 and AT4G05230

DIOPT Version :9

Sequence 1:NP_651212.1 Gene:CG10694 / 42855 FlyBaseID:FBgn0039147 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_192432.1 Gene:AT4G05230 / 825871 AraportID:AT4G05230 Length:206 Species:Arabidopsis thaliana


Alignment Length:223 Identity:40/223 - (17%)
Similarity:86/223 - (38%) Gaps:36/223 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TITLEMNESQEVRALKQKLGNLPEVAMPAENLQLIYSGRIMEDAMPLSEYRIAEDKIIVLMGKKK 76
            |..:|:.....|..:|||:.....:  |.....|::.|.:::|.:.:      |..:|:...:.:
plant    12 TFEIELGYWDTVLEIKQKIEKYQRI--PVSKQTLLFQGNVLQDHLDI------EQCVILNHSRIQ 68

  Fly    77 VDKSSPEEKVAPTPPLAAGPNVLRTEDVVPSLAPNDQWVSDLMSMGYGEEEVRSALRASFNHPER 141
            :..|||::.       .....|.:||....|.:      ::..|.|:.|..|...:..:.|    
plant    69 LSISSPDQS-------RNNIQVFKTEQFPQSNS------TEQTSNGHHESTVMIPMSNNNN---- 116

  Fly   142 AIEYLINGIPQE----VVSEQGLAAIP-SVQTSDQLQQLMADLNITRMREMINQNPELIHRLMNR 201
                  |..|::    |:.:.|...|| .|...|.:.:|..:|...:.|..::...|....:..:
plant   117 ------NNNPKKLRVMVLPKSGTRKIPVDVNAGDNVGELRKELAKIQQRFQLSLPQEGYFFIYKQ 175

  Fly   202 LAETDPATFEVFQRNQEELMNMISGGAS 229
            ....:..:|...:.:|.:.:.:.:|..|
plant   176 NVMDENRSFRWHRVDQGDTIEIFNGSVS 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10694NP_651212.1 rad23 1..284 CDD:273167 40/223 (18%)
UBQ 1..76 CDD:294102 12/63 (19%)
UBA1_Rad23_like 110..148 CDD:270466 5/37 (14%)
XPC-binding 172..227 CDD:286376 6/54 (11%)
UBA2_Rad23_like 245..282 CDD:270467
AT4G05230NP_192432.1 UBQ 1..69 CDD:214563 12/64 (19%)
ubiquitin 7..72 CDD:278661 12/67 (18%)
UBQ 130..198 CDD:176352 11/67 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10621
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.