DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10694 and PI4K GAMMA 4

DIOPT Version :10

Sequence 1:NP_651212.1 Gene:CG10694 / 42855 FlyBaseID:FBgn0039147 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_566076.1 Gene:PI4K GAMMA 4 / 819260 AraportID:AT2G46500 Length:566 Species:Arabidopsis thaliana


Alignment Length:215 Identity:43/215 - (20%)
Similarity:85/215 - (39%) Gaps:65/215 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLS-IRMLDQRT-----ITLEMNESQEVRALKQKLGNLPEVAMPAENLQLIYSGRIMEDAMPLS 59
            :||| :::||.:|     ....:...:.:..:|:::.......:..:..:::|.|..:||...::
plant   105 LKLSDLQVLDVKTTCGKHCRFHVERGRNIGYVKKQISKKRGDFVDPDEQEILYEGEKLEDQSLIN 169

  Fly    60 EYRIAEDKIIVLMGK-------KKVDKS------SPEEK---------VAPTPPLAAGPNVLRTE 102
            :....:|.::.|:.:       |.|:|:      :|:.|         :.|...|:..|.|:.::
plant   170 DICRNDDSVLHLLVRRSAKVRVKPVEKNFELSIVAPQAKDKKGREAKSIVPPKKLSLEPVVVNSK 234

  Fly   103 DVVPSLAPND--QWVSDLMSMGYGEEEVRSALRASFNHPERAIE-----YLING----------- 149
            ..|| |...|  |..||.:..|              |.|.|:.|     |.:.|           
plant   235 AKVP-LVVKDMIQSASDGLKSG--------------NSPVRSSEGTGGAYFMQGPSGNKFVGVFK 284

  Fly   150 -IPQEVVSE---QGLAAIPS 165
             |.:|.::|   |||...|:
plant   285 PIDEEPMAENNPQGLPLSPN 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10694NP_651212.1 rad23 1..284 CDD:273167 43/215 (20%)
PI4K GAMMA 4NP_566076.1 Ubl1_cv_Nsp3_N-like 39..107 CDD:475130 0/1 (0%)
Ubl_ubiquitin_like 115..182 CDD:340559 7/66 (11%)
PI3_PI4_kinase 264..513 CDD:395364 9/41 (22%)

Return to query results.
Submit another query.