DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10694 and AT2G32350

DIOPT Version :9

Sequence 1:NP_651212.1 Gene:CG10694 / 42855 FlyBaseID:FBgn0039147 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_180794.2 Gene:AT2G32350 / 817796 AraportID:AT2G32350 Length:242 Species:Arabidopsis thaliana


Alignment Length:142 Identity:35/142 - (24%)
Similarity:69/142 - (48%) Gaps:25/142 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RTITLEMNESQEVRALKQKLGNLPEVAMPAENLQLIYSG-RIMEDAMPLSEYRIAE-DKIIVLMG 73
            :..|:|::.::.|.:||.|:..:...  |.:.:||.||| .:.:|...|:||.|.| .:|:|.: 
plant    84 KQFTVEVDRTETVSSLKDKIHIVENT--PIKRMQLYYSGIELADDYRNLNEYGITEFSEIVVFL- 145

  Fly    74 KKKVDKSSPEEKVAPTPPLAAGPNVLRTEDVVPSLAPNDQWVSDLMSMGYGEEEVRSALRAS--- 135
             |.::::   :.|||...|..   :::|...:.:.|.....:.|..::    .|:|..|:|:   
plant   146 -KSINRA---KDVAPVRKLCF---LVQTSSSLFNGARIPVEIKDTCTI----SEMREGLQANKTL 199

  Fly   136 ------FNHPER 141
                  |.|.:|
plant   200 PRDEYIFVHKQR 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10694NP_651212.1 rad23 1..284 CDD:273167 35/142 (25%)
UBQ 1..76 CDD:294102 20/66 (30%)
UBA1_Rad23_like 110..148 CDD:270466 8/41 (20%)
XPC-binding 172..227 CDD:286376
UBA2_Rad23_like 245..282 CDD:270467
AT2G32350NP_180794.2 Ubiquitin_like_fold 1..47 CDD:421700
ubiquitin 77..146 CDD:395184 20/65 (31%)
Ubiquitin_like_fold 169..232 CDD:421700 9/47 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10621
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.