DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10694 and Ubl7

DIOPT Version :9

Sequence 1:NP_651212.1 Gene:CG10694 / 42855 FlyBaseID:FBgn0039147 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001116345.1 Gene:Ubl7 / 69459 MGIID:1916709 Length:380 Species:Mus musculus


Alignment Length:216 Identity:49/216 - (22%)
Similarity:92/216 - (42%) Gaps:52/216 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LSIRMLDQ----RTITLEMNESQ---------EVRALKQKL-GNLPEVAMPAENLQLIYSGRIME 53
            |::::.||    ::| |::.|::         .:..|||.: |.|.|.....|.:.|||.||.::
Mouse     8 LAVKLADQPLAPKSI-LQLPETELGEYSLGGYSISFLKQLIAGKLQESVPDPELIDLIYCGRKLK 71

  Fly    54 DAMPLSEYRIAEDKIIVLMGKKKVDKSSPEEKVAPTPPLAAGPNVLRTEDVVPSLAPNDQWVSDL 118
            |...|..|.|.....:.::.|...:   |::|..|...:||    ||...|              
Mouse    72 DDQTLDFYGIQPGSTVHVLRKSWPE---PDQKPEPVDKVAA----LREFRV-------------- 115

  Fly   119 MSMGYGEEEVRSALRASFNHPERAIEYLIN--GIPQEVVSEQGLAAIP---SVQTSDQLQQLMAD 178
                     :.:||.:|.::.|...:.|.|  .:.|.:|:..||::.|   .|.....|..:.||
Mouse   116 ---------LHTALHSSSSYREAVFKMLSNKESLDQIIVATPGLSSDPIALGVLQDKDLFSVFAD 171

  Fly   179 LNITRMREMINQNPELIHRLM 199
            .|:  :..::..:|.|::.::
Mouse   172 PNM--LDTLVPAHPALVNAII 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10694NP_651212.1 rad23 1..284 CDD:273167 49/216 (23%)
UBQ 1..76 CDD:294102 23/86 (27%)
UBA1_Rad23_like 110..148 CDD:270466 5/37 (14%)
XPC-binding 172..227 CDD:286376 6/28 (21%)
UBA2_Rad23_like 245..282 CDD:270467
Ubl7NP_001116345.1 Ubl_UBL7 7..98 CDD:340513 23/93 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..313
UBA_UBL7 <346..375 CDD:270511
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.