DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10694 and Ubl4b

DIOPT Version :9

Sequence 1:NP_651212.1 Gene:CG10694 / 42855 FlyBaseID:FBgn0039147 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_080537.1 Gene:Ubl4b / 67591 MGIID:1914841 Length:188 Species:Mus musculus


Alignment Length:203 Identity:39/203 - (19%)
Similarity:83/203 - (40%) Gaps:55/203 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLSIRMLDQRTITLEMNESQEVRALKQKLGNLPEVAMPAENLQLIYSGRIMEDAMPLSEYRIAE 65
            |.|::::|..|..:|:::..:.|..||:.:..  .:.:|.|...|::.|:::.|...||:|.|..
Mouse     1 MFLTVKLLLGRRCSLKVSGKESVATLKKLVSQ--HLQVPEEQQHLLFRGQLLADDKYLSDYSIGP 63

  Fly    66 DKIIVLMGKKKVDKSSPEEKVAPTPPLAAGPNVLRTEDVVPSLAPNDQW--VSDLMSMGYGEEEV 128
            :..|.::.:...|.:.  :|...|.||                     |  :..::...:|.::.
Mouse    64 NASINVIMRPPEDAAL--DKTHQTQPL---------------------WLQLGQVLDKHFGAKDA 105

  Fly   129 RSALRASF---NHPER-------AIEYLINGIPQEVVSEQGLAAIPSVQTSDQLQQLMADLNITR 183
            ::.|  .|   .|.||       |:|.|:.    :::::|            ||.:|..:.....
Mouse   106 KTVL--GFLRQEHEERLQRLSLEALEQLVG----QLLAQQ------------QLDELAEEKEAPA 152

  Fly   184 MREMINQN 191
            :...:.||
Mouse   153 VASELEQN 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10694NP_651212.1 rad23 1..284 CDD:273167 39/203 (19%)
UBQ 1..76 CDD:294102 18/74 (24%)
UBA1_Rad23_like 110..148 CDD:270466 10/49 (20%)
XPC-binding 172..227 CDD:286376 4/20 (20%)
UBA2_Rad23_like 245..282 CDD:270467
Ubl4bNP_080537.1 UBQ 1..74 CDD:294102 18/74 (24%)
UBQ 1..72 CDD:214563 18/72 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..188 2/15 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.