Sequence 1: | NP_651212.1 | Gene: | CG10694 / 42855 | FlyBaseID: | FBgn0039147 | Length: | 290 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_080537.1 | Gene: | Ubl4b / 67591 | MGIID: | 1914841 | Length: | 188 | Species: | Mus musculus |
Alignment Length: | 203 | Identity: | 39/203 - (19%) |
---|---|---|---|
Similarity: | 83/203 - (40%) | Gaps: | 55/203 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MKLSIRMLDQRTITLEMNESQEVRALKQKLGNLPEVAMPAENLQLIYSGRIMEDAMPLSEYRIAE 65
Fly 66 DKIIVLMGKKKVDKSSPEEKVAPTPPLAAGPNVLRTEDVVPSLAPNDQW--VSDLMSMGYGEEEV 128
Fly 129 RSALRASF---NHPER-------AIEYLINGIPQEVVSEQGLAAIPSVQTSDQLQQLMADLNITR 183
Fly 184 MREMINQN 191 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10694 | NP_651212.1 | rad23 | 1..284 | CDD:273167 | 39/203 (19%) |
UBQ | 1..76 | CDD:294102 | 18/74 (24%) | ||
UBA1_Rad23_like | 110..148 | CDD:270466 | 10/49 (20%) | ||
XPC-binding | 172..227 | CDD:286376 | 4/20 (20%) | ||
UBA2_Rad23_like | 245..282 | CDD:270467 | |||
Ubl4b | NP_080537.1 | UBQ | 1..74 | CDD:294102 | 18/74 (24%) |
UBQ | 1..72 | CDD:214563 | 18/72 (25%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 146..188 | 2/15 (13%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5272 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |