DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10694 and RPS27A

DIOPT Version :9

Sequence 1:	NP_651212.1	Gene:	CG10694 / 42855	FlyBaseID:	FBgn0039147	Length:	290	Species:	Drosophila melanogaster
Sequence 2:	NP_001129064.1	Gene:	RPS27A / 6233	HGNCID:	10417	Length:	156	Species:	Homo sapiens

Alignment Length:	86	Identity:	26/86 - (30%)
Similarity:	49/86 - (56%)	Gaps:	7/86 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly     1 MKLSIRMLDQRTITLEMNESQEVRALKQKLGNLPEVAMPAENLQLIYSGRIMEDAMPLSEYRIAE 65
            |::.::.|..:|||||:..|..:..:|.|:.:  :..:|.:..:||::|:.:||...||:|.|.:
Human     1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQD--KEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK 63

  Fly    66 DKIIVLM-----GKKKVDKSS 81
            :..:.|:     |.||..|.|
Human    64 ESTLHLVLRLRGGAKKRKKKS 84

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10694	NP_651212.1	rad23	1..284	CDD:273167	26/86 (30%)
		UBQ	1..76	CDD:294102	22/79 (28%)
		UBA1_Rad23_like	110..148	CDD:270466
		XPC-binding	172..227	CDD:286376
		UBA2_Rad23_like	245..282	CDD:270467
RPS27A	NP_001129064.1	Ubl_ubiquitin	1..76	CDD:340501	21/76 (28%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	76..95		5/9 (56%)
		Ribosomal_S27	103..147	CDD:396259
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5272
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810