DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10694 and RAD23A

DIOPT Version :9

Sequence 1:NP_651212.1 Gene:CG10694 / 42855 FlyBaseID:FBgn0039147 Length:290 Species:Drosophila melanogaster
Sequence 2:XP_024307399.1 Gene:RAD23A / 5886 HGNCID:9812 Length:382 Species:Homo sapiens


Alignment Length:222 Identity:65/222 - (29%)
Similarity:100/222 - (45%) Gaps:55/222 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LSIRMLDQRTITLEMNESQEVRALKQKL-GNLPEVAMPAENLQLIYSGRIMEDAMPLSEYRIAED 66
            ::::.|.|:|..:.|...:.|:.||:|: ......|.|....:|||:|:|:.|.:|:.:|||.|.
Human     5 ITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIRDYRIDEK 69

  Fly    67 KIIVLMGKK----------------------------------------KVDKSSPEEKVAPTPP 91
            ..:|:|..|                                        :.|||..||....|.|
Human    70 NFVVVMVTKTKAGQGTSAPPEASPTAAPESSTSFPPAPTSGMSHPPPAAREDKSPSEESAPTTSP 134

  Fly    92 LAAGPNVL------RTEDVVPSLAPNDQW---VSDLMSMGYGEEEVRSALRASFNHPERAIEYLI 147
            .:...:|.      |.||...:|....::   ::::|||||..|.|.:|||||:|:|.||:|||:
Human   135 ESVSGSVPSSGSSGREEDAASTLVTGSEYETMLTEIMSMGYERERVVAALRASYNNPHRAVEYLL 199

  Fly   148 NGIPQEVVSEQGLAAIPSVQTSDQLQQ 174
            .|||.....|.|     |||.|...:|
Human   200 TGIPGSPEPEHG-----SVQESQVSEQ 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10694NP_651212.1 rad23 1..284 CDD:273167 65/222 (29%)
UBQ 1..76 CDD:294102 24/113 (21%)
UBA1_Rad23_like 110..148 CDD:270466 19/40 (48%)
XPC-binding 172..227 CDD:286376 1/3 (33%)
UBA2_Rad23_like 245..282 CDD:270467
RAD23AXP_024307399.1 UBQ 3..>228 CDD:333228 65/222 (29%)
DNA_pol3_gamma3 <81..378 CDD:331207 41/146 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159582
Domainoid 1 1.000 49 1.000 Domainoid score I11798
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53856
OrthoDB 1 1.010 - - D1260050at2759
OrthoFinder 1 1.000 - - FOG0001474
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101279
Panther 1 1.100 - - O PTHR10621
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1097
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.750

Return to query results.
Submit another query.