Sequence 1: | NP_651212.1 | Gene: | CG10694 / 42855 | FlyBaseID: | FBgn0039147 | Length: | 290 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_064516.2 | Gene: | UBQLN4 / 56893 | HGNCID: | 1237 | Length: | 601 | Species: | Homo sapiens |
Alignment Length: | 235 | Identity: | 53/235 - (22%) |
---|---|---|---|
Similarity: | 95/235 - (40%) | Gaps: | 54/235 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 41 ENLQLIYSGRIMEDAMPLSEYRIAED---KIIVLMGKKKVDKSSPEEKVAPTPPLAAGPNVLRTE 102
Fly 103 DVVP--------------------------------------SLAPNDQWVSDLMSMGYGE---- 125
Fly 126 EEVRSALRASFNHPERAIEYLINGIPQEVVSEQGLAAIPSVQTSDQLQQLMADLNITRMREMINQ 190
Fly 191 NPELIHRLMNRLAETDPATFEVFQRNQEE-LMNM--ISGG 227 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10694 | NP_651212.1 | rad23 | 1..284 | CDD:273167 | 53/235 (23%) |
UBQ | 1..76 | CDD:294102 | 8/37 (22%) | ||
UBA1_Rad23_like | 110..148 | CDD:270466 | 8/41 (20%) | ||
XPC-binding | 172..227 | CDD:286376 | 22/57 (39%) | ||
UBA2_Rad23_like | 245..282 | CDD:270467 | |||
UBQLN4 | NP_064516.2 | UBQ | 13..83 | CDD:214563 | 8/32 (25%) |
hPLIC_N | 13..83 | CDD:176403 | 8/32 (25%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 87..155 | 7/67 (10%) | |||
STI1 | 192..229 | CDD:128966 | 9/37 (24%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 301..366 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 490..533 | ||||
UBA_PLICs | 558..597 | CDD:270582 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5272 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |