DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10694 and ubl7a

DIOPT Version :9

Sequence 1:NP_651212.1 Gene:CG10694 / 42855 FlyBaseID:FBgn0039147 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001017765.1 Gene:ubl7a / 550462 ZFINID:ZDB-GENE-050417-285 Length:379 Species:Danio rerio


Alignment Length:253 Identity:56/253 - (22%)
Similarity:108/253 - (42%) Gaps:60/253 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KLSIRMLDQRTI---TLEMNESQ---------EVRALKQKL-GNLPEVAMPAENLQLIYSGRIME 53
            :||::::||.::   .|:..|::         .|..|||.: ..:|:.....|.::|:|.||.::
Zfish     7 RLSLKLVDQPSLPKSLLQFPEAEPGDVPPGEYRVSTLKQLVSAQIPDAIPDPELIELVYCGRKLK 71

  Fly    54 DAMPLSEYRIAEDKIIVLMGKKKVDKSSPEEKVAPTPPLAAGPNVLRTEDVVPSLAPNDQWVSDL 118
            |.:.|..|.|.....:.::     .||.||.::.|.|              |..:|...::    
Zfish    72 DDLTLESYGIQSGSTVHIL-----RKSWPEPEIHPEP--------------VDKVAAAREF---- 113

  Fly   119 MSMGYGEEEVRSALRASFNHPERAIEYLIN--GIPQEVVSEQGLAAIP----SVQTSDQLQQLMA 177
                   ..:::||..|..:.|...:.|.|  .:.|.:|:..||::.|    .:|..|...| .|
Zfish   114 -------RVLQAALHTSTAYRESVFKMLNNKESLDQIIVATPGLSSDPVALGVLQDKDLFLQ-FA 170

  Fly   178 DLNITRMREMINQNPELIHRL---MNRLAETDPATFEVFQRNQEELMNMISGGASRTP 232
            |.|:  :..:.|.:|.|::.:   ::.:|.:.|.     |::.....|:.||..|..|
Zfish   171 DPNM--LDTLANSHPALVNAIILVLHSVAGSVPP-----QQSTSSSRNVSSGSYSDMP 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10694NP_651212.1 rad23 1..284 CDD:273167 56/253 (22%)
UBQ 1..76 CDD:294102 20/86 (23%)
UBA1_Rad23_like 110..148 CDD:270466 5/37 (14%)
XPC-binding 172..227 CDD:286376 12/57 (21%)
UBA2_Rad23_like 245..282 CDD:270467
ubl7aNP_001017765.1 UBQ 19..92 CDD:294102 16/77 (21%)
UBQ <40..88 CDD:214563 14/47 (30%)
UBA_UBL7 337..374 CDD:270511
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.