DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10694 and RGD1562433

DIOPT Version :9

Sequence 1:NP_651212.1 Gene:CG10694 / 42855 FlyBaseID:FBgn0039147 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001071146.1 Gene:RGD1562433 / 499222 RGDID:1562433 Length:510 Species:Rattus norvegicus


Alignment Length:263 Identity:53/263 - (20%)
Similarity:110/263 - (41%) Gaps:46/263 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ESQEVRALKQKLGNLPEVAMPAENLQLIYSGRIMEDAMPLSEYRIAEDKIIVLMGKKKVDKSSPE 83
            |:..|...|:::...  :....:.|.|||:|:|::|...||:..|.:...:..:.:.::..|   
  Rat    41 ENSNVHRFKKQISKY--LHCDTDRLVLIYTGKILQDQDILSQRGILDGSTVHAVVRSRLKGS--- 100

  Fly    84 EKVAPTPPLAAGPNVLRTEDVVPS-----LAPNDQWVSDLMSMGYGEEEVRSALRASFNHPERAI 143
               |.|..| |||....|....||     ||.:...::|..|      ::...|.|:   ||..:
  Rat   101 ---ACTGTL-AGPTGHCTHRSEPSVKLGRLARSSPDLADFFS------QLVQLLPAA---PESVV 152

  Fly   144 EYLINGIPQEVVSEQGLAAIPSVQTSDQLQQLMADLNITRMREMINQNPELIHRLMNRLAETDPA 208
            ::|.:.:.|.:.:|:....:...::|..:|:          |:...:.||...:.:.:.      
  Rat   153 QFLEDPLIQGLANEKQANGVHIPESSKTVQK----------RDPALKFPETFQKPVQQQ------ 201

  Fly   209 TFEVFQRNQE--ELMNMISGGASR---TPNEIEHLQITLTAEETAAVGRLEALGFERVMAVQAYL 268
              ||.|.:::  |.:..:.||.:.   :.::|:...::..|...|:.|.:......|..|..|:.
  Rat   202 --EVLQEHKQRLEALKAVPGGDNAMHPSCSDIQQAMLSTLASLVASKGHISGSDLCRGEANNAHS 264

  Fly   269 ACD 271
            :.|
  Rat   265 SLD 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10694NP_651212.1 rad23 1..284 CDD:273167 53/263 (20%)
UBQ 1..76 CDD:294102 13/56 (23%)
UBA1_Rad23_like 110..148 CDD:270466 7/37 (19%)
XPC-binding 172..227 CDD:286376 8/56 (14%)
UBA2_Rad23_like 245..282 CDD:270467 6/27 (22%)
RGD1562433NP_001071146.1 UBQ 24..94 CDD:214563 13/54 (24%)
UBQ 24..94 CDD:294102 13/54 (24%)
UBA_PLICs 467..506 CDD:270582
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.