DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10694 and NOS1

DIOPT Version :9

Sequence 1:NP_651212.1 Gene:CG10694 / 42855 FlyBaseID:FBgn0039147 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001191147.1 Gene:NOS1 / 4842 HGNCID:7872 Length:1468 Species:Homo sapiens


Alignment Length:311 Identity:58/311 - (18%)
Similarity:104/311 - (33%) Gaps:103/311 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 QRTITLE--MNESQEVR-----ALKQKLGNLPEVAMPA----ENLQLI----YSGRIMEDAMP-- 57
            ||.:.|.  :.|.:|.:     .:.:.|...|.:.|||    ..|.|:    ||.....|..|  
Human  1162 QRLLVLSKGLQEYEEWKWGKNPTIVEVLEEFPSIQMPATLLLTQLSLLQPRYYSISSSPDMYPDE 1226

  Fly    58 ------LSEYRIAEDKIIVLMG--KKKVDKSSPEEKV------APT---------PPLAAGPNVL 99
                  :..||..:.:..:..|  ...:::...:|.|      ||:         |.:..||.. 
Human  1227 VHLTVAIVSYRTRDGEGPIHHGVCSSWLNRIQADELVPCFVRGAPSFHLPRNPQVPCILVGPGT- 1290

  Fly   100 RTEDVVPSLAPNDQWVSDLMSMG--------------------YGEEEVRSALRASF-------- 136
               .:.|..:...|...|:...|                    |.||.:::..:..|        
Human  1291 ---GIAPFRSFWQQRQFDIQHKGMNPCPMVLVFGCRQSKIDHIYREETLQAKNKGVFRELYTAYS 1352

  Fly   137 NHPERAIEYLINGIPQE--------VVSEQG---------------LAAIPSVQTSD-QLQQLMA 177
            ..|::..:| :..|.||        .:.|||               |.||..:.|.. :|....|
Human  1353 REPDKPKKY-VQDILQEQLAESVYRALKEQGGHIYVCGDVTMAADVLKAIQRIMTQQGKLSAEDA 1416

  Fly   178 DLNITRMREMINQNPELI------HRLMNRLAETDPATFEVFQRNQEELMN 222
            .:.|:|||:....:.::.      :.:.|||.....|..|..:::.:|:.:
Human  1417 GVFISRMRDDNRYHEDIFGVTLRTYEVTNRLRSESIAFIEESKKDTDEVFS 1467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10694NP_651212.1 rad23 1..284 CDD:273167 58/311 (19%)
UBQ 1..76 CDD:294102 19/90 (21%)
UBA1_Rad23_like 110..148 CDD:270466 9/65 (14%)
XPC-binding 172..227 CDD:286376 12/57 (21%)
UBA2_Rad23_like 245..282 CDD:270467
NOS1NP_001191147.1 PDZ_signaling 15..98 CDD:238492
NOS_oxygenase_euk 305..716 CDD:238410
CysJ 759..1433 CDD:223446 52/275 (19%)
Flavodoxin_1 762..969 CDD:278677
Nitric_oxide_synthase 1035..1438 CDD:99799 52/280 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.75 Normalized mean entropy S1636
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.