DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10694 and CG3223

DIOPT Version :9

Sequence 1:NP_651212.1 Gene:CG10694 / 42855 FlyBaseID:FBgn0039147 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_649758.1 Gene:CG3223 / 40947 FlyBaseID:FBgn0037538 Length:415 Species:Drosophila melanogaster


Alignment Length:346 Identity:65/346 - (18%)
Similarity:121/346 - (34%) Gaps:104/346 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SQEVRALKQKLGNLPEVAMPAENLQLIYSGRIMEDAMPLSEYRIAEDKIIVLMGKKKVDKSSPEE 84
            :::|..||..:.....:...|..|::|:.||::|||..|:  |..:...::.. .:|:.:.||. 
  Fly    24 TRDVAYLKAVVTKEMHLQFDASELEIIHHGRVLEDADTLN--RTLQPNAVIHC-FQKIKRYSPY- 84

  Fly    85 KVAPTPPLAAGPNVLRTEDV----------VPS--------LAPNDQWVSDLMSMGYGEEEVRSA 131
                .||.||..|....:::          |.|        ||...::..:|.:...    :|.:
  Fly    85 ----VPPAAAEINTKHIQELFSLTSHLQISVTSRFNILQKILAEYPEFRRNLGAQAL----IRDS 141

  Fly   132 LRASFNHPERAIEYLINGIPQEVVSEQGLAAIPSVQ-------TSDQLQQLMADLNIT------- 182
            :..:..|....::.|:...|  ::.|.....:.:::       ::.|||:..|..:.|       
  Fly   142 VLFNMLHEPEVVQNLVKDYP--LICEAAPFIVDTIRKELARNSSATQLQEQAASESTTSSEEENS 204

  Fly   183 -----------------------RMREMINQNPELIHRLMNRLAETDP--ATFEVFQRNQEELMN 222
                                   |..||.|.......:|.|.||...|  :...:.|||.:|.:.
  Fly   205 LGAGSSSSGGSSSTAVAAAAAANRRDEMANIRQISRQQLANALANVTPFNSLSNIAQRNADEAVQ 269

  Fly   223 MIS------------GGASRT-------------------PNEIEHLQITLTAEETAAVGRLEAL 256
            ...            |||:.|                   .||:.....:|:.::.|.|..:|..
  Fly   270 GDERPRTTSAPLAGVGGAAGTGAGSSSGAISSGSISSELLRNELARAFQSLSQDQPAPVENMEVE 334

  Fly   257 GFERVMAVQAYL--ACDKDEQ 275
            ..|..:..||..  |.|.|::
  Fly   335 SGEGPVPEQAATAPADDVDDE 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10694NP_651212.1 rad23 1..284 CDD:273167 65/346 (19%)
UBQ 1..76 CDD:294102 13/55 (24%)
UBA1_Rad23_like 110..148 CDD:270466 4/37 (11%)
XPC-binding 172..227 CDD:286376 17/98 (17%)
UBA2_Rad23_like 245..282 CDD:270467 9/33 (27%)
CG3223NP_649758.1 UBA_like_SF 373..410 CDD:304366
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.