DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10694 and Ubi-p63E

DIOPT Version :9

Sequence 1:NP_651212.1 Gene:CG10694 / 42855 FlyBaseID:FBgn0039147 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001261383.1 Gene:Ubi-p63E / 38456 FlyBaseID:FBgn0003943 Length:763 Species:Drosophila melanogaster


Alignment Length:276 Identity:55/276 - (19%)
Similarity:118/276 - (42%) Gaps:41/276 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLSIRMLDQRTITLEMNESQEVRALKQKLGNLPEVAMPAENLQLIYSGRIMEDAMPLSEYRIAE 65
            |::.::.|..:|||||:..|..:..:|.|:.:  :..:|.:..:||::|:.:||...||:|.|.:
  Fly     1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQD--KEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK 63

  Fly    66 DKIIVLMGK---------KKVDKSSPEEKVAPTPPLAAGPNVLRTEDVVPSLAPNDQWVSDLMSM 121
            :..:.|:.:         |.:...:...:|.|:..:......::.::.:|   |:.|   .|:..
  Fly    64 ESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIP---PDQQ---RLIFA 122

  Fly   122 GYGEEEVRSALRASFNHPERAIEYLI----NGIPQEVVSEQGLAAIPSVQTSDQLQQLMADLNIT 182
            |...|:.|:.  :.:|..:.:..:|:    .|:...|.:..|......|:.||.::.:.|.:   
  Fly   123 GKQLEDGRTL--SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKI--- 182

  Fly   183 RMREMINQNPELIHRLMNRLAET-----DPATFEVFQRNQEELMNMI---SGGASRTPNEIEHLQ 239
                   |:.|.|.....||...     |..|...:...:|..::::   .||.......:....
  Fly   183 -------QDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT 240

  Fly   240 ITLTAEETAAVGRLEA 255
            |||..|.:..:..::|
  Fly   241 ITLEVEPSDTIENVKA 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10694NP_651212.1 rad23 1..284 CDD:273167 55/276 (20%)
UBQ 1..76 CDD:294102 21/83 (25%)
UBA1_Rad23_like 110..148 CDD:270466 8/41 (20%)
XPC-binding 172..227 CDD:286376 9/62 (15%)
UBA2_Rad23_like 245..282 CDD:270467 2/11 (18%)
Ubi-p63ENP_001261383.1 Ubiquitin 1..76 CDD:176398 21/76 (28%)
UBQ 1..72 CDD:214563 21/72 (29%)
Ubiquitin 77..152 CDD:176398 12/82 (15%)
UBQ 77..148 CDD:214563 12/78 (15%)
Ubiquitin 153..228 CDD:176398 14/84 (17%)
UBQ 153..224 CDD:214563 14/80 (18%)
Ubiquitin 229..304 CDD:176398 5/28 (18%)
UBQ 229..300 CDD:214563 5/28 (18%)
Ubiquitin 305..380 CDD:176398
UBQ 305..376 CDD:214563
Ubiquitin 381..456 CDD:176398
UBQ 381..452 CDD:214563
Ubiquitin 457..532 CDD:176398
UBQ 457..528 CDD:214563
Ubiquitin 533..608 CDD:176398
UBQ 533..604 CDD:214563
Ubiquitin 609..684 CDD:176398
UBQ 609..680 CDD:214563
Ubiquitin 685..760 CDD:176398
UBQ 685..756 CDD:214563
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.