powered by:
Protein Alignment CG10694 and Nedd8
DIOPT Version :9
Sequence 1: | NP_651212.1 |
Gene: | CG10694 / 42855 |
FlyBaseID: | FBgn0039147 |
Length: | 290 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001286070.1 |
Gene: | Nedd8 / 35151 |
FlyBaseID: | FBgn0032725 |
Length: | 84 |
Species: | Drosophila melanogaster |
Alignment Length: | 72 |
Identity: | 14/72 - (19%) |
Similarity: | 40/72 - (55%) |
Gaps: | 2/72 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MKLSIRMLDQRTITLEMNESQEVRALKQKLGNLPEVAMPAENLQLIYSGRIMEDAMPLSEYRIAE 65
|.:.::.|..:.|.:::..:.:|..:|:::.. :..:|.:..:||:||:.|.|....::|::..
Fly 1 MLIKVKTLTGKEIEIDIEPTDKVDRIKERVEE--KEGIPPQQQRLIFSGKQMNDDKTAADYKVQG 63
Fly 66 DKIIVLM 72
..::.|:
Fly 64 GSVLHLV 70
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5272 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.