DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10694 and Nos

DIOPT Version :9

Sequence 1:NP_651212.1 Gene:CG10694 / 42855 FlyBaseID:FBgn0039147 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_523541.2 Gene:Nos / 34495 FlyBaseID:FBgn0011676 Length:1349 Species:Drosophila melanogaster


Alignment Length:294 Identity:57/294 - (19%)
Similarity:100/294 - (34%) Gaps:100/294 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PAENLQL----IYSGRIMEDAMPLSEYRIAEDKI-----------------IVLMGKKKVDK--- 79
            |.||.:|    :|:.|:.|.    ||:.:.:..|                 :.|...|::|:   
  Fly   730 PPENGELFSQELYAMRVQES----SEHGLQDSSIGSSKSFMKASSRQEFMKLPLQQVKRIDRWDS 790

  Fly    80 -------SSPEEKVAPTPPLAAGPNVLRTEDVVPSLAPNDQWVSD---------LMSMGYGEEEV 128
                   :..||...|...:......|.: ...|:.....|:|.:         |:.:.||:|  
  Fly   791 LRGSTSDTFTEETFGPLSNVRFAVFALGS-SAYPNFCAFGQYVDNILGELGGERLLRVAYGDE-- 852

  Fly   129 RSALRASFNH--PE---RAIE-YLINGIPQEVVSEQGLAAIPSVQTSDQLQQLMADLNITRMREM 187
            ......||..  ||   .|.| :.::  |:|.:|:..||          ||.....:|..|:...
  Fly   853 MCGQEQSFRKWAPEVFKLACETFCLD--PEESLSDASLA----------LQNDSLTVNTVRLVPS 905

  Fly   188 INQ----------NPELIH--------RLMNRLAETDPAT-----------FE------VFQRNQ 217
            .|:          :.:.:|        ..:.||:|....|           :|      :|..|:
  Fly   906 ANKGSLDSSLSKYHNKKVHCCKAKAKPHNLTRLSEGAKTTMLLEICAPGLEYEPGDHVGIFPANR 970

  Fly   218 EELMNMISGGASRTPNEIEHLQITLTAEETAAVG 251
            .||::.:........|..|.||:.|..|:..:.|
  Fly   971 TELVDGLLNRLVGVDNPDEVLQLQLLKEKQTSNG 1004

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10694NP_651212.1 rad23 1..284 CDD:273167 57/294 (19%)
UBQ 1..76 CDD:294102 11/57 (19%)
UBA1_Rad23_like 110..148 CDD:270466 12/52 (23%)
XPC-binding 172..227 CDD:286376 15/89 (17%)
UBA2_Rad23_like 245..282 CDD:270467 2/7 (29%)
NosNP_523541.2 NOS_oxygenase_euk 216..624 CDD:238410
CysJ 669..1323 CDD:223446 57/294 (19%)
Flavodoxin_1 673..863 CDD:278677 26/139 (19%)
Nitric_oxide_synthase 931..1328 CDD:99799 16/74 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.75 Normalized mean entropy S1636
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.