DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10694 and rps27a

DIOPT Version :10

Sequence 1:NP_651212.1 Gene:CG10694 / 42855 FlyBaseID:FBgn0039147 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_956796.1 Gene:rps27a / 337810 ZFINID:ZDB-GENE-030131-10018 Length:156 Species:Danio rerio


Alignment Length:86 Identity:26/86 - (30%)
Similarity:49/86 - (56%) Gaps:7/86 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLSIRMLDQRTITLEMNESQEVRALKQKLGNLPEVAMPAENLQLIYSGRIMEDAMPLSEYRIAE 65
            |::.::.|..:|||||:..|..:..:|.|:.:  :..:|.:..:||::|:.:||...||:|.|.:
Zfish     1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQD--KEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK 63

  Fly    66 DKIIVLM-----GKKKVDKSS 81
            :..:.|:     |.||..|.|
Zfish    64 ESTLHLVLRLRGGAKKRKKKS 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10694NP_651212.1 rad23 1..284 CDD:273167 26/86 (30%)
rps27aNP_956796.1 Ubl_ubiquitin 1..76 CDD:340501 21/76 (28%)
Ribosomal_S27 103..147 CDD:460261
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.