DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10694 and ubqln4

DIOPT Version :9

Sequence 1:NP_651212.1 Gene:CG10694 / 42855 FlyBaseID:FBgn0039147 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_998521.2 Gene:ubqln4 / 334337 ZFINID:ZDB-GENE-030131-6269 Length:599 Species:Danio rerio


Alignment Length:256 Identity:64/256 - (25%)
Similarity:107/256 - (41%) Gaps:55/256 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DQRTITLEMNESQEVRALKQKLGNLPEVAMPAENLQLIYSGRIMEDAMPLSEYRIAEDKIIVLM- 72
            |:..|.:.  |...|...|:::..  ......:.|.||::|:|::|...|.::.|.:...:.|: 
Zfish    35 DKEEIAIA--EDASVAQFKEEISK--RFKAKQDQLVLIFAGKILKDGDTLGQHGIKDGLTVHLVI 95

  Fly    73 ---------GKKKVDKS--------SPEEKVAPTP------PLAAGPNVLRTEDVVPSLAPN--- 111
                     |..:...|        ||.....|:|      |..:||:      ..||...|   
Zfish    96 KTAQKTSGAGSSQTSASSGPGPSQGSPSGTDTPSPAGNLGTPQGSGPS------PTPSQPANILA 154

  Fly   112 ---DQWVSDLMSMGYGE----EEVRSALRASFNHPERAIEYLINGIPQEVVSEQGLAAIPSVQTS 169
               |  :|.|.::|.|.    |..:...|...::||...:.:.|.:.|.::|...|.. ..:..:
Zfish   155 GFGD--LSGLSNLGMGSANFMELQQQMQRQLMSNPEMLSQIMENPLVQSMMSNPDLMR-QMIMAN 216

  Fly   170 DQLQQLMADLNITRMREMINQNPELIHRLMNRLAETDPATFEVFQRNQEE-LMNM--ISGG 227
            .|:|||| :.| ..:..|:| ||||:.:.| .||. :||..:...|||:. |.|:  |.||
Zfish   217 PQMQQLM-ERN-PEISHMLN-NPELMRQTM-ELAR-NPAMMQEMMRNQDRALSNLESIPGG 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10694NP_651212.1 rad23 1..284 CDD:273167 64/256 (25%)
UBQ 1..76 CDD:294102 15/76 (20%)
UBA1_Rad23_like 110..148 CDD:270466 10/47 (21%)
XPC-binding 172..227 CDD:286376 22/57 (39%)
UBA2_Rad23_like 245..282 CDD:270467
ubqln4NP_998521.2 UBQ 26..96 CDD:214563 14/64 (22%)
hPLIC_N 26..96 CDD:176403 14/64 (22%)
STI1 186..223 CDD:128966 9/37 (24%)
UBA_PLICs 556..595 CDD:270582
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.