DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10694 and Ubqln2

DIOPT Version :9

Sequence 1:NP_651212.1 Gene:CG10694 / 42855 FlyBaseID:FBgn0039147 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001101721.1 Gene:Ubqln2 / 317396 RGDID:1563566 Length:638 Species:Rattus norvegicus


Alignment Length:286 Identity:62/286 - (21%)
Similarity:115/286 - (40%) Gaps:68/286 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ESQEVRALKQKLGNLPEVAMPAENLQLIYSGRIMEDAMPLSEYRIAEDKIIVLMGKKKVDKSSPE 83
            |:..|:..|:.:..  ......:.|.||::|:|::|...|.::.|.:...:.|:.|   .::.|:
  Rat    50 ENSTVQQFKEAISK--RFKSQTDQLVLIFAGKILKDQDTLIQHGIHDGLTVHLVIK---SQNRPQ 109

  Fly    84 EKVAPTPPLAAGPNVLRTEDVVPSLAP-------------------NDQWVSDLMSMG-YG---- 124
            .:....|...||.:...|.....:..|                   ::..:..|.|:| .|    
  Rat   110 GQATTQPSTTAGTSTTTTTTTTAAAPPAATTSSAPRCSTTATTTNSSNLGLGSLASLGNLGLNSS 174

  Fly   125 -----EEEVRSALRASFNHPERAIEYLINGIPQEVVSEQGLAAIPSVQTSDQLQQLMADLNITRM 184
                 :.:::..|.||   ||..|:.:.|...|.::|...|          ..|.:||:   .:|
  Rat   175 NFTELQNQMQQQLLAS---PEMMIQIMENPFVQSMLSNPDL----------MRQLIMAN---PQM 223

  Fly   185 REMINQNPELIHRLMNR--LAET-----DPATFEVFQRNQE-ELMNM--ISGGAS---RTPNEIE 236
            :::|.:|||:.|.|.|.  :.:|     :||..:...|||: .|.|:  |.||.:   |...:|:
  Rat   224 QQLIQRNPEISHLLNNPDIMRQTLEIARNPAMMQEMMRNQDLALSNLESIPGGYNALRRMYTDIQ 288

  Fly   237 HLQITLTAEE-----TAAVGRLEALG 257
            ...:....|:     .|.||...:.|
  Rat   289 EPMLNAAQEQFGGNPFATVGSSSSSG 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10694NP_651212.1 rad23 1..284 CDD:273167 62/286 (22%)
UBQ 1..76 CDD:294102 13/56 (23%)
UBA1_Rad23_like 110..148 CDD:270466 11/66 (17%)
XPC-binding 172..227 CDD:286376 20/64 (31%)
UBA2_Rad23_like 245..282 CDD:270467 5/18 (28%)
Ubqln2NP_001101721.1 UBQ 33..103 CDD:214563 12/54 (22%)
hPLIC_N 33..103 CDD:176403 12/54 (22%)
STI1 194..227 CDD:128966 9/45 (20%)
STI1 393..440 CDD:128966
UBA_PLICs 595..634 CDD:270582
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.