DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10694 and Oasl2

DIOPT Version :9

Sequence 1:NP_651212.1 Gene:CG10694 / 42855 FlyBaseID:FBgn0039147 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001009682.1 Gene:Oasl2 / 304549 RGDID:1307351 Length:511 Species:Rattus norvegicus


Alignment Length:105 Identity:19/105 - (18%)
Similarity:37/105 - (35%) Gaps:18/105 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 ELIHRLMNRLAETDPATFEVFQRNQEELMNMISGGASRTPNEIEH--------LQITLTAEETAA 249
            |.|.|........|    |:....:..::.::.||:|.....:.|        .....::.:..|
  Rat    38 ERIERFFREKCFCD----ELLLDQEVRVLKVVKGGSSGKGTALNHRSDQDMILFLSCFSSFKQQA 98

  Fly   250 VGRLEALGFERVMAVQAYLACDKDEQLAAEVLIRQSEEDR 289
            ..|...:.|.:...:.    |.|  .||..:.:||.:|.:
  Rat    99 RDRKAVIDFIKSKLIH----CRK--SLAYNITVRQHKEGK 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10694NP_651212.1 rad23 1..284 CDD:273167 16/98 (16%)
UBQ 1..76 CDD:294102
UBA1_Rad23_like 110..148 CDD:270466
XPC-binding 172..227 CDD:286376 5/33 (15%)
UBA2_Rad23_like 245..282 CDD:270467 7/36 (19%)
Oasl2NP_001009682.1 NT_2-5OAS_ClassI-CCAase 29..214 CDD:143390 19/105 (18%)
OAS1_C 170..347 CDD:402171
Ubl1_OASL 359..432 CDD:340509
Ubl2_OASL 438..509 CDD:340520
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.