DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10694 and Oasl

DIOPT Version :10

Sequence 1:NP_651212.1 Gene:CG10694 / 42855 FlyBaseID:FBgn0039147 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001009681.1 Gene:Oasl / 304545 RGDID:1308586 Length:512 Species:Rattus norvegicus


Alignment Length:69 Identity:19/69 - (27%)
Similarity:36/69 - (52%) Gaps:10/69 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VRALKQKLGNLPEVAMPAENLQLIYSGRIMEDAMPLSEYRIAEDKIIVLMGKKKVDKSSPEEKVA 87
            |.:|||::.:  ...:.::..||.:.||::||......|.| :|.|.:::.:|:..|       |
  Rat   453 VLSLKQQIED--RQGLQSQEQQLEFQGRVLEDWFDFKSYGI-QDSITIILSRKREGK-------A 507

  Fly    88 PTPP 91
            |:.|
  Rat   508 PSAP 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10694NP_651212.1 rad23 1..284 CDD:273167 19/69 (28%)
OaslNP_001009681.1 NT_2-5OAS_ClassI-CCAase 29..209 CDD:143390
OAS1_C 167..348 CDD:463087
Ubl1_OASL 351..424 CDD:340509
Ubl1_cv_Nsp3_N-like 430..501 CDD:475130 14/50 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.