powered by:
Protein Alignment CG10694 and Oasl
DIOPT Version :9
Sequence 1: | NP_651212.1 |
Gene: | CG10694 / 42855 |
FlyBaseID: | FBgn0039147 |
Length: | 290 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001009681.1 |
Gene: | Oasl / 304545 |
RGDID: | 1308586 |
Length: | 512 |
Species: | Rattus norvegicus |
Alignment Length: | 69 |
Identity: | 19/69 - (27%) |
Similarity: | 36/69 - (52%) |
Gaps: | 10/69 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 23 VRALKQKLGNLPEVAMPAENLQLIYSGRIMEDAMPLSEYRIAEDKIIVLMGKKKVDKSSPEEKVA 87
|.:|||::.: ...:.::..||.:.||::||......|.| :|.|.:::.:|:..| |
Rat 453 VLSLKQQIED--RQGLQSQEQQLEFQGRVLEDWFDFKSYGI-QDSITIILSRKREGK-------A 507
Fly 88 PTPP 91
|:.|
Rat 508 PSAP 511
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5272 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.