DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10694 and Oasl

DIOPT Version :9

Sequence 1:NP_651212.1 Gene:CG10694 / 42855 FlyBaseID:FBgn0039147 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001009681.1 Gene:Oasl / 304545 RGDID:1308586 Length:512 Species:Rattus norvegicus


Alignment Length:69 Identity:19/69 - (27%)
Similarity:36/69 - (52%) Gaps:10/69 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VRALKQKLGNLPEVAMPAENLQLIYSGRIMEDAMPLSEYRIAEDKIIVLMGKKKVDKSSPEEKVA 87
            |.:|||::.:  ...:.::..||.:.||::||......|.| :|.|.:::.:|:..|       |
  Rat   453 VLSLKQQIED--RQGLQSQEQQLEFQGRVLEDWFDFKSYGI-QDSITIILSRKREGK-------A 507

  Fly    88 PTPP 91
            |:.|
  Rat   508 PSAP 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10694NP_651212.1 rad23 1..284 CDD:273167 19/69 (28%)
UBQ 1..76 CDD:294102 14/52 (27%)
UBA1_Rad23_like 110..148 CDD:270466
XPC-binding 172..227 CDD:286376
UBA2_Rad23_like 245..282 CDD:270467
OaslNP_001009681.1 NT_2-5OAS_ClassI-CCAase 29..209 CDD:143390
OAS1_C 167..347 CDD:287404
UBQ 351..430 CDD:294102
UBQ 431..499 CDD:214563 14/48 (29%)
ubiquitin 436..502 CDD:278661 14/51 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.