powered by:
Protein Alignment CG10694 and Isg15
DIOPT Version :9
Sequence 1: | NP_651212.1 |
Gene: | CG10694 / 42855 |
FlyBaseID: | FBgn0039147 |
Length: | 290 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001100170.1 |
Gene: | Isg15 / 298693 |
RGDID: | 1310312 |
Length: | 161 |
Species: | Rattus norvegicus |
Alignment Length: | 71 |
Identity: | 19/71 - (26%) |
Similarity: | 37/71 - (52%) |
Gaps: | 4/71 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 LSIRMLDQ--RTITLEMNESQEVRALKQKLGNLPEVAMPAENLQLIYSGRIMEDAMPLSEYRIAE 65
|||.:.:: |:...|:..:|.|..|.:::....:|:. :...|.::||.|||..||.||.:..
Rat 81 LSILVRNERGRSNVYEVQLTQTVEVLMRQVSQHEQVSQ--DQFWLSFNGRPMEDKEPLGEYGLTP 143
Fly 66 DKIIVL 71
...:::
Rat 144 HCTVIM 149
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5272 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.