DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10694 and Ubqlnl

DIOPT Version :9

Sequence 1:NP_651212.1 Gene:CG10694 / 42855 FlyBaseID:FBgn0039147 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001013921.1 Gene:Ubqlnl / 293287 RGDID:1307202 Length:612 Species:Rattus norvegicus


Alignment Length:244 Identity:53/244 - (21%)
Similarity:90/244 - (36%) Gaps:61/244 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DQRTITLEMNESQEVRALKQKLGNLPEVAMPAENLQLIYSGRIMEDAMPLSEYRIAEDKIIVLMG 73
            :|...|:.  |...||..|::|.:..:..|  |.|.|:..||:::|...||:..|.:...|.::.
  Rat    40 NQNVFTVA--EDTSVRQFKEQLSSHFKCQM--EQLVLVSMGRLLKDHDTLSQRGITDGHTIHVVI 100

  Fly    74 KKKVDKSSPEEKVAPTPPLAAGPNVLRTEDVVPSLAPNDQWVSDLMSMGYGEEEVRSALRASFNH 138
            |.|....|......         |:|..........|.....:...|.|..|.:|.|::      
  Rat   101 KSKHGSRSLTHSFR---------NLLTNNPCHQDRNPKGNSSTVCQSAGMSETKVESSI------ 150

  Fly   139 PERAIEYLINGIPQEVVSEQGLAAIPSVQTSDQLQQLMADLNITR-----------------MRE 186
                   |:.....:|.::.     |.|.:.:|::|::..|.:.|                 |::
  Rat   151 -------LMEPDASKVCTQD-----PEVGSPEQIEQMLETLCVQRLLSNMFFMHQLPPEHPDMQD 203

  Fly   187 MINQNPELIHRLMN--------RLAETDPATFEVFQ-----RNQEELMN 222
            :|.||||:.|.|.|        .||.......|:.|     :|.|..:|
  Rat   204 LIQQNPEVSHLLDNSEILCQTLELARHLAIIQEIMQIQQPAQNPEHTLN 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10694NP_651212.1 rad23 1..284 CDD:273167 53/244 (22%)
UBQ 1..76 CDD:294102 19/66 (29%)
UBA1_Rad23_like 110..148 CDD:270466 7/37 (19%)
XPC-binding 172..227 CDD:286376 19/81 (23%)
UBA2_Rad23_like 245..282 CDD:270467
UbqlnlNP_001013921.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
UBQ 31..101 CDD:214563 18/64 (28%)
UBQ 31..101 CDD:294102 18/64 (28%)
UBA_PLICs 569..606 CDD:270582
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.