DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10694 and Ubd

DIOPT Version :9

Sequence 1:NP_651212.1 Gene:CG10694 / 42855 FlyBaseID:FBgn0039147 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_445751.2 Gene:Ubd / 29168 RGDID:69418 Length:161 Species:Rattus norvegicus


Alignment Length:176 Identity:36/176 - (20%)
Similarity:70/176 - (39%) Gaps:52/176 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ITLEMNESQEVRALKQKLGNLPEVAMPAENLQLIYSGRIMEDAMPLSEYRIAEDKIIVLMGKKKV 77
            :|.:...|.:|:.:.:.:.:..:|::  ::..|:...:|::....||.|.|.::..|.|  ..||
  Rat    16 MTFDTTMSDKVKKINEHIRSQTKVSV--QDQILLLDSKILKPHRALSSYGIDKENTIHL--TLKV 76

  Fly    78 DKSSPEEKVAPTPPLAAGPNVLRTEDVVPSLAPNDQWVSDLMSMGYGEEEVRSALRASFNHPERA 142
            .|.|.||.     ||:          :|.|                |:|..|..||...:.....
  Rat    77 VKPSDEEL-----PLS----------LVES----------------GDEGQRHLLRVRRSSSVAQ 110

  Fly   143 IEYLINGIPQEVVSEQGLAAIPSVQ-----TSDQLQ--QLMADLNI 181
            ::.:|          :.:.|:|..:     ...:|:  ::|||.||
  Rat   111 VKEMI----------ENVTAVPPKKQFVNCNGKRLEDGKIMADYNI 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10694NP_651212.1 rad23 1..284 CDD:273167 36/176 (20%)
UBQ 1..76 CDD:294102 12/62 (19%)
UBA1_Rad23_like 110..148 CDD:270466 5/37 (14%)
XPC-binding 172..227 CDD:286376 6/12 (50%)
UBA2_Rad23_like 245..282 CDD:270467
UbdNP_445751.2 UBQ 8..75 CDD:214563 12/62 (19%)
UBQ 17..75 CDD:294102 12/61 (20%)
UBQ 92..154 CDD:214563 14/65 (22%)
ubiquitin 95..154 CDD:278661 12/62 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.