DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10694 and Oas1h

DIOPT Version :9

Sequence 1:NP_651212.1 Gene:CG10694 / 42855 FlyBaseID:FBgn0039147 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_660263.1 Gene:Oas1h / 246729 MGIID:2180853 Length:369 Species:Mus musculus


Alignment Length:171 Identity:30/171 - (17%)
Similarity:51/171 - (29%) Gaps:51/171 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 SLAPNDQWVSDLMSMGY--GEEEVRSALRASFN---------------HPERAIEYLINGIPQEV 154
            :|.....|..|....|:  |:....:.||...|               ||.|....::.|.....
Mouse    11 ALCSTPAWRLDKFIEGHLLGDITFLTELRTDVNSISAFLKERCFQGAAHPMRVSRVVMGGSYNRY 75

  Fly   155 VSEQGLAAIPSVQTSDQLQQLMADLNITRMREMINQNPELIHRLMNRLAETDPATFEVFQRNQEE 219
            ...:|         ..::..|:...|:|...:......|:|..:...|.:        ||: ::.
Mouse    76 TVLKG---------RSEVDLLVFFNNLTCFDDQFKLQKEVIEEIQKHLCQ--------FQQ-EKR 122

  Fly   220 LMNMISGGASRTPN---------------EIE-HLQITLTA 244
            |.......:|..||               |:| |:|....|
Mouse   123 LREKFKVQSSDQPNFRSVSFKLSYPKFQQEVEFHMQTAYDA 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10694NP_651212.1 rad23 1..284 CDD:273167 30/171 (18%)
UBQ 1..76 CDD:294102
UBA1_Rad23_like 110..148 CDD:270466 10/54 (19%)
XPC-binding 172..227 CDD:286376 9/54 (17%)
UBA2_Rad23_like 245..282 CDD:270467 30/171 (18%)
Oas1hNP_660263.1 NT_2-5OAS_ClassI-CCAase 34..>164 CDD:143390 25/148 (17%)
OAS1_C 175..361 CDD:287404
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.