DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10694 and Ubqln3

DIOPT Version :9

Sequence 1:NP_651212.1 Gene:CG10694 / 42855 FlyBaseID:FBgn0039147 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001371113.1 Gene:Ubqln3 / 244178 MGIID:3045291 Length:681 Species:Mus musculus


Alignment Length:237 Identity:52/237 - (21%)
Similarity:102/237 - (43%) Gaps:61/237 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VRALKQKLGNLPEVAMPAENLQLIYSGRIMEDAMPLSEYRIAED---KIIVLMGKKKVDKSSPEE 84
            :|.||:|:.:..: |.| ..|.||::|:|::|...|::..:.:.   .:::.|.::.:...    
Mouse    66 IRQLKEKISHRFK-AHP-NQLVLIFAGKILKDPDSLAQCGVRDGLTVHLVIKMQRRTIGTE---- 124

  Fly    85 KVAPTPPLA-AGPNVLRTEDVVPSLAPNDQWVSDL------------------MSMGYGEEEVRS 130
              .|:||:: .|||        |...|....|..:                  ::.|...::..|
Mouse   125 --CPSPPVSIPGPN--------PGEIPQSSSVYSVDGSPSFSLGVLTGLSGLGLTSGSFSDQPGS 179

  Fly   131 ALRASFNHPERAIEYLINGIPQEVVSEQGLAAIPSVQTSDQLQQLMADLNITRMREMINQNPELI 195
            .:....:.||...:.:.:...|.::|..||           ::||:  |:...|:.:|.||||:.
Mouse   180 LMWQHISVPELVAQLVDDPFIQGLLSNTGL-----------VRQLV--LDNPHMQHLIQQNPEIG 231

  Fly   196 HRLMNR--LAET-----DPATFEVFQRNQEE-LMNM--ISGG 227
            |.|.|.  :.:|     :|:..:...|:|:. |.|:  |.||
Mouse   232 HILNNPEIMRQTMEFLRNPSMMQEMMRSQDRALSNLESIPGG 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10694NP_651212.1 rad23 1..284 CDD:273167 52/237 (22%)
UBQ 1..76 CDD:294102 14/55 (25%)
UBA1_Rad23_like 110..148 CDD:270466 6/55 (11%)
XPC-binding 172..227 CDD:286376 19/64 (30%)
UBA2_Rad23_like 245..282 CDD:270467
Ubqln3NP_001371113.1 Ubl_PLICs 43..115 CDD:340506 13/50 (26%)
STI1 212..256 CDD:128966 14/45 (31%)
UBA_PLICs 641..678 CDD:270582
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.