DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10694 and Ubb

DIOPT Version :9

Sequence 1:NP_651212.1 Gene:CG10694 / 42855 FlyBaseID:FBgn0039147 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001300913.1 Gene:Ubb / 22187 MGIID:98888 Length:305 Species:Mus musculus


Alignment Length:276 Identity:55/276 - (19%)
Similarity:118/276 - (42%) Gaps:41/276 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLSIRMLDQRTITLEMNESQEVRALKQKLGNLPEVAMPAENLQLIYSGRIMEDAMPLSEYRIAE 65
            |::.::.|..:|||||:..|..:..:|.|:.:  :..:|.:..:||::|:.:||...||:|.|.:
Mouse     1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQD--KEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK 63

  Fly    66 DKIIVLMGK---------KKVDKSSPEEKVAPTPPLAAGPNVLRTEDVVPSLAPNDQWVSDLMSM 121
            :..:.|:.:         |.:...:...:|.|:..:......::.::.:|   |:.|   .|:..
Mouse    64 ESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIP---PDQQ---RLIFA 122

  Fly   122 GYGEEEVRSALRASFNHPERAIEYLI----NGIPQEVVSEQGLAAIPSVQTSDQLQQLMADLNIT 182
            |...|:.|:.  :.:|..:.:..:|:    .|:...|.:..|......|:.||.::.:.|.:   
Mouse   123 GKQLEDGRTL--SDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKI--- 182

  Fly   183 RMREMINQNPELIHRLMNRLAET-----DPATFEVFQRNQEELMNMI---SGGASRTPNEIEHLQ 239
                   |:.|.|.....||...     |..|...:...:|..::::   .||.......:....
Mouse   183 -------QDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT 240

  Fly   240 ITLTAEETAAVGRLEA 255
            |||..|.:..:..::|
Mouse   241 ITLEVEPSDTIENVKA 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10694NP_651212.1 rad23 1..284 CDD:273167 55/276 (20%)
UBQ 1..76 CDD:294102 21/83 (25%)
UBA1_Rad23_like 110..148 CDD:270466 8/41 (20%)
XPC-binding 172..227 CDD:286376 9/62 (15%)
UBA2_Rad23_like 245..282 CDD:270467 2/11 (18%)
UbbNP_001300913.1 Ubl_ubiquitin 1..76 CDD:340501 21/76 (28%)
Ubl_ubiquitin 77..152 CDD:340501 12/82 (15%)
Ubl_ubiquitin 153..228 CDD:340501 14/84 (17%)
Ubl_ubiquitin 229..304 CDD:340501 5/28 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.