DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10694 and Nedd8

DIOPT Version :10

Sequence 1:NP_651212.1 Gene:CG10694 / 42855 FlyBaseID:FBgn0039147 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_032709.1 Gene:Nedd8 / 18002 MGIID:97301 Length:81 Species:Mus musculus


Alignment Length:72 Identity:16/72 - (22%)
Similarity:40/72 - (55%) Gaps:2/72 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLSIRMLDQRTITLEMNESQEVRALKQKLGNLPEVAMPAENLQLIYSGRIMEDAMPLSEYRIAE 65
            |.:.::.|..:.|.:::..:.:|..:|:::..  :..:|.:..:|||||:.|.|....::|:|..
Mouse     1 MLIKVKTLTGKEIEIDIEPTDKVERIKERVEE--KEGIPPQQQRLIYSGKQMNDEKTAADYKILG 63

  Fly    66 DKIIVLM 72
            ..::.|:
Mouse    64 GSVLHLV 70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10694NP_651212.1 rad23 1..284 CDD:273167 16/72 (22%)
Nedd8NP_032709.1 Ubl_NEDD8 3..76 CDD:340504 15/70 (21%)
Interaction with UBE1C. /evidence=ECO:0000250|UniProtKB:Q15843 70..72 0/1 (0%)

Return to query results.
Submit another query.