DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10694 and UBQLNL

DIOPT Version :9

Sequence 1:NP_651212.1 Gene:CG10694 / 42855 FlyBaseID:FBgn0039147 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_659490.4 Gene:UBQLNL / 143630 HGNCID:28294 Length:475 Species:Homo sapiens


Alignment Length:283 Identity:52/283 - (18%)
Similarity:105/283 - (37%) Gaps:77/283 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KLSIRMLDQRTITLEMNESQEVRALKQKLGNLPEVAMPAENLQL-----IYSGRIMEDAMP---- 57
            ::|..:||...|.|:..|.....|:.|:   :.::..|::||:.     .|.|.   :.||    
Human   210 EVSRLLLDNSEILLQTLELARNLAMIQE---IMQIQQPSQNLEYPLNPQPYLGL---ETMPGGNN 268

  Fly    58 -LSE-YRIAEDKIIVLMGKKKVDKSSPEEKVAPTP--PLAAGPNVLRTEDVVPSLAPNDQWVSDL 118
             |.: |....|:::          :|.::.....|  .|.||..:.:.:...|...|:.:....|
Human   269 ALGQNYADINDQML----------NSMQDPFGGNPFTALLAGQVLEQVQSSPPPPPPSQEQQDQL 323

  Fly   119 -----------MSMGYGEEEVRSALRASFNHPERAIEYLINGIPQEVV----SEQGLAAIPSVQT 168
                       .|.|:......:......||..:|...:|:...|..:    ....:.|:||::.
Human   324 TQHPATRVIYNSSGGFSSNTSANDTLNKVNHTSKANTAMISTKGQSHICATRQPAWIPALPSIEL 388

  Fly   169 SDQLQQ---------------LMADLNIT----------RMREMINQNPELIHRLMNRLAETDPA 208
            :.|||:               |..||.::          .|.:::..||.|..::|  |..:.|.
Human   389 TQQLQEEYKDATVSLSSSRQTLKGDLQLSDEQSSSQITGGMMQLLMNNPYLAAQIM--LFTSMPQ 451

  Fly   209 TFEVFQR------NQEELMNMIS 225
            ..|.:::      .|.::.:::|
Human   452 LSEQWRQQLPTFLQQTQISDLLS 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10694NP_651212.1 rad23 1..284 CDD:273167 52/283 (18%)
UBQ 1..76 CDD:294102 18/84 (21%)
UBA1_Rad23_like 110..148 CDD:270466 7/48 (15%)
XPC-binding 172..227 CDD:286376 15/85 (18%)
UBA2_Rad23_like 245..282 CDD:270467
UBQLNLNP_659490.4 UBQ 32..101 CDD:214563
UBQ 32..101 CDD:294102
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 113..138
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..325 3/19 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.