DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10694 and Fau

DIOPT Version :9

Sequence 1:NP_651212.1 Gene:CG10694 / 42855 FlyBaseID:FBgn0039147 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001153711.1 Gene:Fau / 14109 MGIID:102547 Length:133 Species:Mus musculus


Alignment Length:134 Identity:31/134 - (23%)
Similarity:50/134 - (37%) Gaps:41/134 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLSIRMLDQRTITLEMNESQEVRALKQKLGNLPEVAMPAENLQLIYSGRIMEDAMPLSEY---- 61
            |:|.:|.  |...|||:...:.|..:|..:.:|..:| |.:.:.|: :|..:||...|.:.    
Mouse     1 MQLFVRA--QELHTLEVTGQETVAQIKDHVASLEGIA-PEDQVVLL-AGSPLEDEATLGQCGVEA 61

  Fly    62 --------RIAEDKI---IVLMGK-----KKVDKSSPEEK-----------------VAPTPPLA 93
                    |:...|:   :...||     .||.|...::|                 |.||....
Mouse    62 LTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKK 126

  Fly    94 AGPN 97
            .|||
Mouse   127 KGPN 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10694NP_651212.1 rad23 1..284 CDD:273167 31/134 (23%)
UBQ 1..76 CDD:294102 21/94 (22%)
UBA1_Rad23_like 110..148 CDD:270466
XPC-binding 172..227 CDD:286376
UBA2_Rad23_like 245..282 CDD:270467
FauNP_001153711.1 Ubl_FUBI 1..74 CDD:340491 18/76 (24%)
Ribosomal_S30 75..132 CDD:398432 13/56 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.