DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10694 and UBD

DIOPT Version :10

Sequence 1:NP_651212.1 Gene:CG10694 / 42855 FlyBaseID:FBgn0039147 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_006389.2 Gene:UBD / 10537 HGNCID:18795 Length:165 Species:Homo sapiens


Alignment Length:80 Identity:22/80 - (27%)
Similarity:40/80 - (50%) Gaps:4/80 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IRMLDQRTITLEMNESQEVRALKQKLGNLPEVAMPAENLQLIYSGRIMEDAMPLSEYRIAEDKII 69
            :|..:...:|.:.|....|:.:|:.:.:..:|  |.::..|:...:|::....||.|.|.::|.|
Human    12 VRSEEWDLMTFDANPYDSVKKIKEHVRSKTKV--PVQDQVLLLGSKILKPRRSLSSYGIDKEKTI 74

  Fly    70 VLMGKKKVDKSSPEE 84
            .|  ..||.|.|.||
Human    75 HL--TLKVVKPSDEE 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10694NP_651212.1 rad23 1..284 CDD:273167 22/80 (28%)
UBDNP_006389.2 Ubl1_FAT10 9..82 CDD:340572 18/73 (25%)
Ubl2_FAT10 90..159 CDD:340573
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.