DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10694 and zfand4

DIOPT Version :9

Sequence 1:NP_651212.1 Gene:CG10694 / 42855 FlyBaseID:FBgn0039147 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001189400.1 Gene:zfand4 / 100148477 ZFINID:ZDB-GENE-090312-102 Length:673 Species:Danio rerio


Alignment Length:241 Identity:47/241 - (19%)
Similarity:86/241 - (35%) Gaps:76/241 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLSIRMLDQRTITLEMNESQEVRALKQKLGNLPEVAMPAENLQLIYSGRIMEDAMPLSEYRIAE 65
            |:|.|..|......|.::..::|.::|.|:..|.  .:|.....||::|..:||...|.:|.|.|
Zfish    28 MELFIETLTGTCFQLRVSPFEQVVSVKAKIQRLE--GIPVSQQHLIWNGMELEDEYCLHDYSITE 90

  Fly    66 D---KIIVLMGKKKVDKSSPEEKVAPTPPLAAGP----NVLRTEDVVPSLAPNDQWVSDLMSMGY 123
            .   |:::.|                    ..||    .|..|:|.|..       :||.:..|.
Zfish    91 GCTLKLVLAM--------------------RGGPVNTRRVTVTDDSVRD-------ISDCLDAGR 128

  Fly   124 GEEEVRSALRASFNHPERAIEYLI----------------NGIPQEVVSEQGLAAIPSVQ----- 167
            .|...:|.       |.:.:.:|:                :|....|......|::.:|:     
Zfish   129 EEMWEKSL-------PNKQVTFLVYREGDQLNFFRVVDRGDGTLTPVSESLSGASVRNVRAEEEE 186

  Fly   168 ----TSDQLQQLMADLNITRMREM--------INQNPELIHRLMNR 201
                .|.:||.|...:.:.:|:.:        :|:.|:...:|..|
Zfish   187 EQESASSELQTLENSITMGKMKLLKAKMENMNLNKKPKKTAKLKIR 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10694NP_651212.1 rad23 1..284 CDD:273167 47/241 (20%)
UBQ 1..76 CDD:294102 21/77 (27%)
UBA1_Rad23_like 110..148 CDD:270466 7/53 (13%)
XPC-binding 172..227 CDD:286376 8/38 (21%)
UBA2_Rad23_like 245..282 CDD:270467
zfand4NP_001189400.1 AN1_N 1..103 CDD:176397 21/96 (22%)
UBQ 28..99 CDD:214563 20/72 (28%)
ZnF_AN1 613..651 CDD:197545
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.