DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10694 and Isg15

DIOPT Version :9

Sequence 1:	NP_651212.1	Gene:	CG10694 / 42855	FlyBaseID:	FBgn0039147	Length:	290	Species:	Drosophila melanogaster
Sequence 2:	NP_056598.2	Gene:	Isg15 / 100038882	MGIID:	1855694	Length:	161	Species:	Mus musculus

Alignment Length:	70	Identity:	14/70 - (20%)
Similarity:	34/70 - (48%)	Gaps:	2/70 - (2%)

- Green bases have known domain annotations that are detailed below.

  Fly     3 LSIRMLDQRTITLEMNESQEVRALKQKLGNLPEVAMPAENLQLIYSGRIMEDAMPLSEYRIAEDK 67
            |.::||......:.:..|..|..||:::..  ::.:||...:|.:...:::|.:.||...:....
Mouse     5 LKVKMLGGNDFLVSVTNSMTVSELKKQIAQ--KIGVPAFQQRLAHQTAVLQDGLTLSSLGLGPSS 67

  Fly    68 IIVLM 72
            .::|:
Mouse    68 TVMLV 72

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10694	NP_651212.1	rad23	1..284	CDD:273167	14/70 (20%)
		UBQ	1..76	CDD:294102	14/70 (20%)
		UBA1_Rad23_like	110..148	CDD:270466
		XPC-binding	172..227	CDD:286376
		UBA2_Rad23_like	245..282	CDD:270467
Isg15	NP_056598.2	Ubl1_ISG15	3..75	CDD:340490	14/70 (20%)
		Ubl2_ISG15	80..153	CDD:340508
		LRLRGG. /evidence=ECO:0000250	150..155
		Involved in the ligation of specific target proteins. /evidence=ECO:0000250	151..155
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5272
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900