DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx1A and STX11

DIOPT Version :9

Sequence 1:NP_001189276.1 Gene:Syx1A / 42854 FlyBaseID:FBgn0013343 Length:296 Species:Drosophila melanogaster
Sequence 2:XP_011534515.1 Gene:STX11 / 8676 HGNCID:11429 Length:313 Species:Homo sapiens


Alignment Length:282 Identity:80/282 - (28%)
Similarity:153/282 - (54%) Gaps:10/282 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDRLAAL---------HAAQSDDEEETEVAVNVDGHDSYMDDFFAQVEEIRGMIDKVQDNVEEVK 58
            |||||.|         .....|||.::.....|...|..::..:..:.:|:.....:..:|:.:.
Human    28 KDRLAELLDLSKQYDQQFPDGDDEFDSPHEDIVFETDHILESLYRDIRDIQDENQLLVADVKRLG 92

  Fly    59 KKHSAILSAPQTDEKTKQELEDLMADIKKNANRVRGKLKGIEQNIE-QEEQQNKSSADLRIRKTQ 122
            |:::..|::.:.....|::...:...||.....:..||:.:::..| .|.|....||..||.:.|
Human    93 KQNARFLTSMRRLSSIKRDTNSIAKAIKARGEVIHCKLRAMKELSEAAEAQHGPHSAVARISRAQ 157

  Fly   123 HSTLSRKFVEVMTEYNRTQTDYRERCKGRIQRQLEITGRPTNDDELEKMLEEGNSSVFTQGIIME 187
            ::.|:..|...|.:||:.:...|:.||.||||||||.|:..:.|::|.|.|:|...||::.::.:
Human   158 YNALTLTFQRAMHDYNQAEMKQRDNCKIRIQRQLEIMGKEVSGDQIEDMFEQGKWDVFSENLLAD 222

  Fly   188 TQQAKQTLADIEARHQDIMKLETSIKELHDMFMDMAMLVESQGEMIDRIEYHVEHAMDYVQTATQ 252
            .:.|:..|.:||:||:::::||:.|:::|::|:.||:|||.|.:.::.||.:|:..:||...|..
Human   223 VKGARAALNEIESRHRELLRLESRIRDVHELFLQMAVLVEKQADTLNVIELNVQKTVDYTGQAKA 287

  Fly   253 DTKKALKYQSKARRKKIMILIC 274
            ..:||::|:.|...:.:....|
Human   288 QVRKAVQYEEKNPCRTLCCFCC 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx1ANP_001189276.1 Syntaxin 33..230 CDD:395647 57/197 (29%)
SNARE 231..281 CDD:399038 11/44 (25%)
STX11XP_011534515.1 Syntaxin 67..264 CDD:279182 57/196 (29%)
SynN 67..219 CDD:238105 41/151 (27%)
SNARE_syntaxin11 229..291 CDD:277231 22/61 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5074
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1033833at2759
OrthoFinder 1 1.000 - - FOG0000185
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.