DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx1A and SYP124

DIOPT Version :9

Sequence 1:NP_001189276.1 Gene:Syx1A / 42854 FlyBaseID:FBgn0013343 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001319282.1 Gene:SYP124 / 842423 AraportID:AT1G61290 Length:303 Species:Arabidopsis thaliana


Alignment Length:294 Identity:82/294 - (27%)
Similarity:144/294 - (48%) Gaps:46/294 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 AQSDDEEETEVAVNVDGHDSYMDDFFAQVEEIRG-------MIDKVQDNVEEVKKKHSAILSAPQ 69
            ||.||.|..:..:|       :|.||..||.::.       :...:||:.||.|..|:|      
plant    19 AQMDDIESGKETMN-------LDKFFEDVENVKDNMKGVETLYKSLQDSNEECKTVHNA------ 70

  Fly    70 TDEKTKQELEDLMADIKKNANRVRGKLKGIEQNIEQEEQQNKSSADL----------RIRKTQHS 124
                  :::::|.|.:..:..:|..::|.|:|.:|..|:.|.:|.::          |.|.:..|
plant    71 ------KKVKELRAKMDGDVAQVLKRVKMIKQKLEALEKANANSRNVSGCGPGSSTDRTRTSVVS 129

  Fly   125 TLSRKFVEVMTEYN----RTQTDYRERCKGRIQRQLEITGRPTNDDELEKMLEEGNSSVFTQGII 185
            .|.:|..::|..:.    |...:|:|..:   :|...|||...::..:|.::..|.|..|.|..|
plant   130 GLGKKLKDLMDSFQGLRARMNAEYKETVE---RRYFTITGEQADEQTIENLISSGESENFLQKAI 191

  Fly   186 ME--TQQAKQTLADIEARHQDIMKLETSIKELHDMFMDMAMLVESQGEMIDRIEYHVEHAMDYVQ 248
            .|  ..|...|:::|:.||..:.::|.::.|||.:|:|||.||||||:.::.||.||..|..:|:
plant   192 QEQGRGQILDTISEIQERHDAVKEIEKNLIELHQVFLDMAALVESQGQQLNDIESHVSKASSFVR 256

  Fly   249 TATQDTKKALKYQSKARR-KKIMILICLTVLGIL 281
            ..|...:.|.:||..:|: ....||:.:.|..:|
plant   257 RGTDQLQDAREYQKSSRKWTCYAILLFIVVFALL 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx1ANP_001189276.1 Syntaxin 33..230 CDD:395647 59/219 (27%)
SNARE 231..281 CDD:399038 14/50 (28%)
SYP124NP_001319282.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2612
eggNOG 1 0.900 - - E1_COG5074
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 116 1.000 Inparanoid score I2016
OMA 1 1.010 - - QHG53912
OrthoDB 1 1.010 - - D1033833at2759
OrthoFinder 1 1.000 - - FOG0000185
OrthoInspector 1 1.000 - - otm2646
orthoMCL 1 0.900 - - OOG6_100497
Panther 1 1.100 - - O PTHR19957
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.880

Return to query results.
Submit another query.