DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx1A and SYP125

DIOPT Version :9

Sequence 1:NP_001189276.1 Gene:Syx1A / 42854 FlyBaseID:FBgn0013343 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_172591.1 Gene:SYP125 / 837666 AraportID:AT1G11250 Length:298 Species:Arabidopsis thaliana


Alignment Length:293 Identity:80/293 - (27%)
Similarity:142/293 - (48%) Gaps:45/293 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 AQSDDEEETEVAVNVDGHDSYMDDFFAQVEEIR-------GMIDKVQDNVEEVKKKHSAILSAPQ 69
            ||..|.|..:..:|       :|.||..||.::       .:..|:||:.||.|..|:|      
plant    14 AQLGDVEAGQETMN-------LDKFFEDVENVKDDMKGVEALYKKLQDSNEECKTVHNA------ 65

  Fly    70 TDEKTKQELEDLMADIKKNANRVRGKLKGIEQNIEQEEQQNKSSADL----------RIRKTQHS 124
                  :::::|.|.:..:...|..::|.|:|.:|..|:.|.:|.::          |.|.:..|
plant    66 ------KKVKELRAKMDGDVAMVLKRVKIIKQKLEALEKANANSRNVPGCGPGSSTDRTRSSVVS 124

  Fly   125 TLSRKFVEVMTEYN----RTQTDYRERCKGRIQRQLEITGRPTNDDELEKMLEEGNSSVFTQGII 185
            .|.:|..::|..:.    |...:|:|..:   :|...|||...::..::.::..|.|..|.|..|
plant   125 GLGKKLKDLMDSFQGLRARMNNEYKETVE---RRYFTITGEKADEQTIDNLIASGESENFLQKAI 186

  Fly   186 ME--TQQAKQTLADIEARHQDIMKLETSIKELHDMFMDMAMLVESQGEMIDRIEYHVEHAMDYVQ 248
            .|  ..|...|:::|:.||..:.::|.::.|||.:|:|||.|||:||:.::.||.||..|..:|:
plant   187 QEQGRGQILDTISEIQERHDAVKEIEKNLLELHQVFLDMAALVEAQGQQLNNIESHVAKASSFVR 251

  Fly   249 TATQDTKKALKYQSKARRKKIMILICLTVLGIL 281
            ..|...:.|.:||..:|:.....:|...|:.||
plant   252 RGTDQLQDAREYQKSSRKWTCYAIILFIVIFIL 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx1ANP_001189276.1 Syntaxin 33..230 CDD:395647 58/219 (26%)
SNARE 231..281 CDD:399038 13/49 (27%)
SYP125NP_172591.1 Syntaxin 28..233 CDD:395647 58/219 (26%)
SNARE 201..267 CDD:419871 26/65 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2612
eggNOG 1 0.900 - - E1_COG5074
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 116 1.000 Inparanoid score I2016
OMA 1 1.010 - - QHG53912
OrthoDB 1 1.010 - - D1033833at2759
OrthoFinder 1 1.000 - - FOG0000185
OrthoInspector 1 1.000 - - otm2646
orthoMCL 1 0.900 - - OOG6_100497
Panther 1 1.100 - - O PTHR19957
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.880

Return to query results.
Submit another query.