DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx1A and SYP111

DIOPT Version :9

Sequence 1:NP_001189276.1 Gene:Syx1A / 42854 FlyBaseID:FBgn0013343 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_172332.1 Gene:SYP111 / 837378 AraportID:AT1G08560 Length:310 Species:Arabidopsis thaliana


Alignment Length:318 Identity:82/318 - (25%)
Similarity:153/318 - (48%) Gaps:42/318 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTKD-------RLAALHAAQSDDEEETEVA-VNVDGHDSYMDDFFAQVEEIRGMIDKVQDNVEEV 57
            |||.       :.||:...::..:.:.|:| ...|..|..:..|..:.|.::..:..:.:.:..:
plant     5 MTKSFMSYVDLKKAAMKDMEAGPDFDLEMASTKADKMDENLSSFLEEAEYVKAEMGLISETLARI 69

  Fly    58 KKKHSAILSAPQTDEKTKQELEDLMADIKKNANRVRG---KLKGIEQNIEQEEQQNKSSADL--- 116
            ::.|.        :.|...:.|.:.:...|.:|.:..   |.|.|:..:|:.::.||....|   
plant    70 EQYHE--------ESKGVHKAESVKSLRNKISNEIVSGLRKAKSIKSKLEEMDKANKEIKRLSGT 126

  Fly   117 ---RIRKTQHSTLSRKFVEVMTEY----NRTQTDYRERCKGRIQRQLEITGRPTNDDELEKMLEE 174
               |.|....:.|.:|..|||.|:    .:..::|:|..:   :|...:||...||:.:||::.:
plant   127 PVYRSRTAVTNGLRKKLKEVMMEFQGLRQKMMSEYKETVE---RRYFTVTGEHANDEMIEKIITD 188

  Fly   175 --GNSSVFTQGIIMETQQAK--QTLADIEARHQDIMKLETSIKELHDMFMDMAMLVESQGEMIDR 235
              |.....|:. |.|..:.|  :|:.:|:.|:....::|.|:.|||.:|:|||::||||||.:|.
plant   189 NAGGEEFLTRA-IQEHGKGKVLETVVEIQDRYDAAKEIEKSLLELHQVFLDMAVMVESQGEQMDE 252

  Fly   236 IEYHVEHAMDYVQTATQDTKKALKYQSKARRKK-----IMILICLTVLGILAASYVSS 288
            ||:||.:|..||.....:.|.|..:|..:|:..     :::||.|.|:..:..|:.||
plant   253 IEHHVINASHYVADGANELKTAKSHQRNSRKWMCIGIIVLLLIILIVVIPIITSFSSS 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx1ANP_001189276.1 Syntaxin 33..230 CDD:395647 51/213 (24%)
SNARE 231..281 CDD:399038 17/54 (31%)
SYP111NP_172332.1 Syntaxin 45..247 CDD:279182 51/213 (24%)
SynN 45..199 CDD:238105 33/164 (20%)
SNARE_syntaxin1-like 211..273 CDD:277201 26/61 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2612
eggNOG 1 0.900 - - E1_COG5074
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 116 1.000 Inparanoid score I2016
OMA 1 1.010 - - QHG53912
OrthoDB 1 1.010 - - D1033833at2759
OrthoFinder 1 1.000 - - FOG0000185
OrthoInspector 1 1.000 - - otm2646
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19957
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.980

Return to query results.
Submit another query.