DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx1A and SYP132

DIOPT Version :9

Sequence 1:NP_001189276.1 Gene:Syx1A / 42854 FlyBaseID:FBgn0013343 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001190256.1 Gene:SYP132 / 830702 AraportID:AT5G08080 Length:315 Species:Arabidopsis thaliana


Alignment Length:305 Identity:84/305 - (27%)
Similarity:154/305 - (50%) Gaps:40/305 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LHAAQSDDEEETEVAVNVDGHDSYMDDFFAQVEEIRGMIDKVQDNVEEVKKK---HSAILS---- 66
            |...||..|.:.|:. ...|.|..::|||.:|:    :|||..|.::::.||   :.::.|    
plant    11 LPRGQSSREGDVELG-EQQGGDQGLEDFFKKVQ----VIDKQYDKLDKLLKKLQIYDSVASQLPC 70

  Fly    67 APQTDEKT----------KQELEDLMADIKKNANRVRGKLKGIE-QNIEQEEQQN--KSSADLRI 118
            |...:.|:          |:.:|..:.::...|..::|||:.:: :|:...::..  |.|...|.
plant    71 ASHEESKSVTKAPAMKAIKKTMEKDVDEVGSIARFIKGKLEELDRENLANRQKPGCAKGSGVDRS 135

  Fly   119 RKTQHSTLSRKFVEVMTEY----NRTQTDYRERCKGRIQRQLEITGRPTNDDELEKMLEEGNSSV 179
            |.....:|.:|..:.|.|:    ...|.:||:....|:   ..:||...::|.:::::|.|||..
plant   136 RTATTLSLKKKLKDKMAEFQVLRENIQQEYRDVVDRRV---YTVTGERADEDTIDELIETGNSEQ 197

  Fly   180 FTQGIIME--TQQAKQTLADIEARHQDIMKLETSIKELHDMFMDMAMLVESQGEMIDRIEYHVEH 242
            ..|..|.|  ..|...|||:|:.||..:..||..:.:|..:|:|||:||::||||:|.||..|..
plant   198 IFQKAIQEQGRGQVMDTLAEIQERHDAVRDLEKKLLDLQQIFLDMAVLVDAQGEMLDNIESQVSS 262

  Fly   243 AMDYVQTATQDTKKALKYQSKARRKK------IMILICLTVLGIL 281
            |:|:||:.....::|...|..:|:..      ::|::.:.|:|:|
plant   263 AVDHVQSGNTALQRAKSLQKNSRKWMCIAIIILLIVVAVIVVGVL 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx1ANP_001189276.1 Syntaxin 33..230 CDD:395647 58/222 (26%)
SNARE 231..281 CDD:399038 16/55 (29%)
SYP132NP_001190256.1 Syntaxin 34..250 CDD:279182 58/222 (26%)
SynN 34..202 CDD:238105 40/174 (23%)
SNARE_syntaxin1-like 214..276 CDD:277201 27/61 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2612
eggNOG 1 0.900 - - E1_COG5074
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H37941
Inparanoid 1 1.050 116 1.000 Inparanoid score I2016
OMA 1 1.010 - - QHG53912
OrthoDB 1 1.010 - - D1033833at2759
OrthoFinder 1 1.000 - - FOG0000185
OrthoInspector 1 1.000 - - otm2646
orthoMCL 1 0.900 - - OOG6_100497
Panther 1 1.100 - - O PTHR19957
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.880

Return to query results.
Submit another query.