DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx1A and Stx4

DIOPT Version :9

Sequence 1:NP_001189276.1 Gene:Syx1A / 42854 FlyBaseID:FBgn0013343 Length:296 Species:Drosophila melanogaster
Sequence 2:XP_006230407.1 Gene:Stx4 / 81803 RGDID:621019 Length:462 Species:Rattus norvegicus


Alignment Length:271 Identity:111/271 - (40%)
Similarity:171/271 - (63%) Gaps:8/271 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDRLAALHAAQ--SDDEEETEVAVNVDGHDSYM----DDFFAQVEEIRGMIDKVQDNVEEVKKKH 61
            :||...|....  ||||:|..||:.|....:.:    |:||.:|:.||..:.|::..|.|::|:.
  Rat     2 RDRTHELRQGDNISDDEDEVRVALVVHSGAARLSSPDDEFFQKVQTIRQTMAKLESKVRELEKQQ 66

  Fly    62 SAILSAPQTDEKTKQELEDLMADIKKNANRVRGKLKGIEQNIEQEEQQNKSSADLRIRKTQHSTL 126
            ..||:.|..:|..||.|::|..:||:....||.:||.||.. ::|..:|.:|.:.|::||||..|
  Rat    67 VTILATPLPEESMKQGLQNLREEIKQLGREVRAQLKAIEPQ-KEEADENYNSVNTRMKKTQHGVL 130

  Fly   127 SRKFVEVMTEYNRTQTDYRERCKGRIQRQLEITGR-PTNDDELEKMLEEGNSSVFTQGIIMETQQ 190
            |::|||::.:.|..|::|||:...||:|||:||.. ..:|:|||:||:.|.|.||...|:.:||.
  Rat   131 SQQFVELINKCNSMQSEYREKNVERIRRQLKITNAGMVSDEELEQMLDSGQSEVFVSNILKDTQV 195

  Fly   191 AKQTLADIEARHQDIMKLETSIKELHDMFMDMAMLVESQGEMIDRIEYHVEHAMDYVQTATQDTK 255
            .:|.|.:|.|||.:|.:||.||:|||::|..:|..||.|||||:|||.::..:.|||:...:..|
  Rat   196 TRQALNEISARHSEIQQLERSIRELHEIFTFLATEVEMQGEMINRIEKNILSSADYVERGQEHVK 260

  Fly   256 KALKYQSKARR 266
            .||:.|.|||:
  Rat   261 IALENQKKARK 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx1ANP_001189276.1 Syntaxin 33..230 CDD:395647 82/201 (41%)
SNARE 231..281 CDD:399038 16/36 (44%)
Stx4XP_006230407.1 Syntaxin 39..235 CDD:279182 82/196 (42%)
SynN 39..189 CDD:238105 61/150 (41%)
SNARE_syntaxin4 199..260 CDD:277236 28/60 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353298
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5074
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53912
OrthoDB 1 1.010 - - D1033833at2759
OrthoFinder 1 1.000 - - FOG0000185
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.760

Return to query results.
Submit another query.