DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx1A and Stx11

DIOPT Version :9

Sequence 1:NP_001189276.1 Gene:Syx1A / 42854 FlyBaseID:FBgn0013343 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001157062.1 Gene:Stx11 / 74732 MGIID:1921982 Length:287 Species:Mus musculus


Alignment Length:288 Identity:86/288 - (29%)
Similarity:160/288 - (55%) Gaps:22/288 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDRLAAL-HAAQSDDEEETEVAVNVDG---HDSYMDDFFAQ----VEEIRGMIDKVQD------- 52
            |||||.| ..::|.|::..      ||   .|:..:|...:    :|.:..:|..:||       
Mouse     2 KDRLAELQELSRSYDQQFP------DGDNDFDAPREDIVFETDHILESLYRVIQDIQDENQLLLI 60

  Fly    53 NVEEVKKKHSAILSAPQTDEKTKQELEDLMADIKKNANRVRGKLKGIEQNIEQEEQQNKS-SADL 116
            :|..:.:::...|::.:.....|::...:...||.....:..||:.:::..||.|.::.: ||..
Mouse    61 DVRRLGRQNVRFLTSMRRLSSIKRDTNSIAKAIKTRGEGIHQKLRSMKELSEQAEARHGAHSAVA 125

  Fly   117 RIRKTQHSTLSRKFVEVMTEYNRTQTDYRERCKGRIQRQLEITGRPTNDDELEKMLEEGNSSVFT 181
            ||...|:|.|:|.|.:.|.|||:.:...|:.||.||||||||.|:..:.:::|.|.|:|...||:
Mouse   126 RISHAQYSALARAFQQAMYEYNQAEMKQRDNCKIRIQRQLEIMGKDMSGEQIEDMFEQGKWDVFS 190

  Fly   182 QGIIMETQQAKQTLADIEARHQDIMKLETSIKELHDMFMDMAMLVESQGEMIDRIEYHVEHAMDY 246
            :.::.:.:.|:..|.:||:||:::::||..|:::|::|:.||:|||.|.:.::.||.:|:..:||
Mouse   191 ENLLADLKGARAALNEIESRHRELLRLEGRIRDVHELFLQMAVLVEKQEDTLNVIELNVQKTLDY 255

  Fly   247 VQTATQDTKKALKYQSKARRKKIMILIC 274
            ...|....:||::|:.|...:.|....|
Mouse   256 TGEAKAQVRKAVQYKKKNPCRTICCFCC 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx1ANP_001189276.1 Syntaxin 33..230 CDD:395647 62/208 (30%)
SNARE 231..281 CDD:399038 12/44 (27%)
Stx11NP_001157062.1 Syntaxin 41..238 CDD:366315 61/196 (31%)
SNARE 207..273 CDD:389950 24/65 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5074
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1033833at2759
OrthoFinder 1 1.000 - - FOG0000185
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.