DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx1A and Stx19

DIOPT Version :9

Sequence 1:NP_001189276.1 Gene:Syx1A / 42854 FlyBaseID:FBgn0013343 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_080864.1 Gene:Stx19 / 68159 MGIID:1915409 Length:292 Species:Mus musculus


Alignment Length:300 Identity:85/300 - (28%)
Similarity:151/300 - (50%) Gaps:46/300 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDRLAALHAAQSDDEEETEVAVNVDGHDSYMDDFFAQVEEIRGM--------------------I 47
            ||||..|      .::..|:.::.||.        ..|||.:|:                    |
Mouse     2 KDRLQEL------KQKTKEIELSRDGQ--------VFVEEEQGVLVQQAVIYEREPVAERHLHEI 52

  Fly    48 DKVQDN----VEEVKK---KHSAILSAPQTDEKTKQELEDLMADIKKNANRVRGKLKGIEQNIEQ 105
            .|:|:|    |::|::   :..:::::.:.....|:: ..:..:||..|..:...|..:.:.:::
Mouse    53 QKLQENINSFVDDVQRFGQQQKSLVASMRRFSLLKRD-STIAKEIKIQAEHINRALGDVVKEVKK 116

  Fly   106 EEQQN-KSSADLRIRKTQHSTLSRKFVEVMTEYNRTQTDYRERCKGRIQRQLEITGRPTNDDELE 169
            .|.:| .||...||.|:|::.:.|:|.:.|..||.|....:|:||..|.||||:.|:..:::|:.
Mouse   117 SEVENGPSSVVTRILKSQYAAMFRRFQQTMFLYNDTIALKQEKCKTFIVRQLEVAGKEVSEEEVN 181

  Fly   170 KMLEEGNSSVFTQGIIMETQQAKQTLADIEARHQDIMKLETSIKELHDMFMDMAMLVESQGEMID 234
            .||..|...||.:.::.||...|..|::||.||::::.||..:|:|.|:|:.:::|||.|||.|:
Mouse   182 DMLHHGKWEVFNESLLTETSITKAQLSEIEQRHKELVNLENQVKDLRDLFIQISLLVEEQGESIN 246

  Fly   235 RIEYHVEHAMDYVQTATQDTKKALKYQSKARRKKIMILIC 274
            .||..|....|||....:....|:||:   :|.....|.|
Mouse   247 SIEVMVNSTKDYVNNTKEKFGLAVKYK---KRNPCRALCC 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx1ANP_001189276.1 Syntaxin 33..230 CDD:395647 61/224 (27%)
SNARE 231..281 CDD:399038 13/43 (30%)
Stx19NP_080864.1 SynN 45..194 CDD:238105 40/149 (27%)
Syntaxin 46..242 CDD:279182 57/196 (29%)
SNARE 206..268 CDD:304603 24/61 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5074
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1033833at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.