DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx1A and STX3

DIOPT Version :9

Sequence 1:NP_001189276.1 Gene:Syx1A / 42854 FlyBaseID:FBgn0013343 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_004168.1 Gene:STX3 / 6809 HGNCID:11438 Length:289 Species:Homo sapiens


Alignment Length:284 Identity:167/284 - (58%)
Similarity:223/284 - (78%) Gaps:10/284 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDRLAALHA---AQSDDEEETEVAVNVDGHDSYMDDFFAQVEEIRGMIDKVQDNVEEVKKKHSAI 64
            ||||..|.|   .|.||.:..|:|::   :.::||:||:::||.|..|||:.::|||.||.:|.|
Human     2 KDRLEQLKAKQLTQDDDTDAVEIAID---NTAFMDEFFSEIEETRLNIDKISEHVEEAKKLYSII 63

  Fly    65 LSAPQTDEKTKQELEDLMADIKKNANRVRGKLKGIEQNIEQEEQQNKSSADLRIRKTQHSTLSRK 129
            ||||..:.|||.:||.|..:|||.||.||.|||.:|::||::|.  :|||||||||:|||.||||
Human    64 LSAPIPEPKTKDDLEQLTTEIKKRANNVRNKLKSMEKHIEEDEV--RSSADLRIRKSQHSVLSRK 126

  Fly   130 FVEVMTEYNRTQTDYRERCKGRIQRQLEITGRPTNDDELEKMLEEGNSSVFTQGIIMETQQAKQT 194
            ||||||:||..|.|:|||.||||||||||||:.|.|:|||:|||.||.::||.||| ::|.:||.
Human   127 FVEVMTKYNEAQVDFRERSKGRIQRQLEITGKKTTDEELEEMLESGNPAIFTSGII-DSQISKQA 190

  Fly   195 LADIEARHQDIMKLETSIKELHDMFMDMAMLVESQGEMIDRIEYHVEHAMDYVQTATQDTKKALK 259
            |::||.||:||::||:|||||||||||:|||||:||||:|.||.:|.|.:|:|:.|..:||||:|
Human   191 LSEIEGRHKDIVRLESSIKELHDMFMDIAMLVENQGEMLDNIELNVMHTVDHVEKARDETKKAVK 255

  Fly   260 YQSKARRKKIMILICLTV-LGILA 282
            |||:||:|.|:|::.:.| |||||
Human   256 YQSQARKKLIIIIVLVVVLLGILA 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx1ANP_001189276.1 Syntaxin 33..230 CDD:395647 125/196 (64%)
SNARE 231..281 CDD:399038 26/50 (52%)
STX3NP_004168.1 Syntaxin 32..226 CDD:307101 125/196 (64%)
SNARE 194..260 CDD:328933 44/65 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159281
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5074
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53912
OrthoDB 1 1.010 - - D1033833at2759
OrthoFinder 1 1.000 - - FOG0000185
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.820

Return to query results.
Submit another query.