DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx1A and zgc:165520

DIOPT Version :9

Sequence 1:NP_001189276.1 Gene:Syx1A / 42854 FlyBaseID:FBgn0013343 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001295756.1 Gene:zgc:165520 / 571872 ZFINID:ZDB-GENE-070620-13 Length:285 Species:Danio rerio


Alignment Length:287 Identity:152/287 - (52%)
Similarity:220/287 - (76%) Gaps:5/287 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDRLAALHAAQSDDEEETEVAVNVDGHDSYMDDFFAQVEEIRGMIDKVQDNVEEVKKKHSAILSA 67
            ||||..|.:......::.|:.:.   :..:||:||||:||||..|||:.:||.|:|:.:|.||||
Zfish     2 KDRLEQLKSKSDQTADDVEIPME---NKEFMDEFFAQIEEIRTSIDKIDENVVEIKRLYSVILSA 63

  Fly    68 PQTDEKTKQELEDLMADIKKNANRVRGKLKGIEQNIEQEEQQNKSSADLRIRKTQHSTLSRKFVE 132
            |.:::||:.|||.:..:|||.||..|.|||.||||:....:: :.|||:||:|:||:.|::||||
Zfish    64 PTSEQKTQDELEAVTNEIKKLANNARNKLKSIEQNLAANTEE-RVSADMRIKKSQHAILAKKFVE 127

  Fly   133 VMTEYNRTQTDYRERCKGRIQRQLEITGRPTNDDELEKMLEEGNSSVFTQGIIMETQQAKQTLAD 197
            |||:||..|.::||:.||||||||||||:.|.|:|||:||:.||::|||.| ||::..:||.|::
Zfish   128 VMTKYNEAQVEFREKSKGRIQRQLEITGKATTDEELEEMLDGGNAAVFTAG-IMDSGISKQALSE 191

  Fly   198 IEARHQDIMKLETSIKELHDMFMDMAMLVESQGEMIDRIEYHVEHAMDYVQTATQDTKKALKYQS 262
            |||||:|||:||:|||||||||:|:|:|||:||.||||||.:::.::.:|:.|..|||||.|:|.
Zfish   192 IEARHKDIMRLESSIKELHDMFVDIAVLVENQGSMIDRIESNMDQSVGFVERAVADTKKAAKFQQ 256

  Fly   263 KARRKKIMILICLTVLGILAASYVSSY 289
            :|||||:||::|.|:|.::..|.|.|:
Zfish   257 EARRKKMMIMLCCTILAVIGGSLVYSW 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx1ANP_001189276.1 Syntaxin 33..230 CDD:395647 116/196 (59%)
SNARE 231..281 CDD:399038 25/49 (51%)
zgc:165520NP_001295756.1 Syntaxin 29..224 CDD:279182 116/196 (59%)
SynN 29..179 CDD:238105 87/151 (58%)
SNARE 188..255 CDD:304603 41/66 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595406
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53912
OrthoDB 1 1.010 - - D1033833at2759
OrthoFinder 1 1.000 - - FOG0000185
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.