DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx1A and stx19

DIOPT Version :9

Sequence 1:NP_001189276.1 Gene:Syx1A / 42854 FlyBaseID:FBgn0013343 Length:296 Species:Drosophila melanogaster
Sequence 2:XP_021334545.1 Gene:stx19 / 570366 ZFINID:ZDB-GENE-150909-2 Length:296 Species:Danio rerio


Alignment Length:243 Identity:70/243 - (28%)
Similarity:138/243 - (56%) Gaps:2/243 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 MDDFFAQVEEIRGMIDKVQDNVEEVKKKHSAILSAPQTDEKTKQELEDLMADIKKNANRVRGKLK 97
            ::.|....:.||..|:::...|.:..::....::..:.....|:| .::..|||..|..:..:|.
Zfish    51 LEIFLKDAQGIRDSIEELNSEVSKFNEQQKNFVATMRRLSIMKKE-SNMTRDIKLLAESLHKRLD 114

  Fly    98 GIEQNIEQEEQQ-NKSSADLRIRKTQHSTLSRKFVEVMTEYNRTQTDYRERCKGRIQRQLEITGR 161
            .:.:..:|.|.: ..::...||:|.||:.|..:|.:||.::|......:|:||..|.||||::||
Zfish   115 ALSKQAKQTEAELGPNATTSRIQKIQHAALFLQFHQVMRQHNDAILSKQEKCKQFIIRQLEVSGR 179

  Fly   162 PTNDDELEKMLEEGNSSVFTQGIIMETQQAKQTLADIEARHQDIMKLETSIKELHDMFMDMAMLV 226
            ..:::|::.|:|:|...:|.:.||::.:..:..|::||.||::::.||:::|:|.|:|:|:.|||
Zfish   180 EVSEEEVDNMIEQGKWEIFNENIIVDAKITRTQLSEIEQRHKELLNLESNMKDLRDLFLDVFMLV 244

  Fly   227 ESQGEMIDRIEYHVEHAMDYVQTATQDTKKALKYQSKARRKKIMILIC 274
            |.||..|..|:.:||...|||....:..|:|.:|:.....:::....|
Zfish   245 EEQGHQIQNIQANVEKTQDYVSVTKEKFKRAARYKKNNPLRRLCCCCC 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx1ANP_001189276.1 Syntaxin 33..230 CDD:395647 57/197 (29%)
SNARE 231..281 CDD:399038 11/44 (25%)
stx19XP_021334545.1 Syntaxin 51..248 CDD:307101 57/197 (29%)
SNARE 216..282 CDD:328933 27/65 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1033833at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.