DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx1A and stx19

DIOPT Version :9

Sequence 1:NP_001189276.1 Gene:Syx1A / 42854 FlyBaseID:FBgn0013343 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001016670.1 Gene:stx19 / 549424 XenbaseID:XB-GENE-5749239 Length:292 Species:Xenopus tropicalis


Alignment Length:252 Identity:78/252 - (30%)
Similarity:150/252 - (59%) Gaps:3/252 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 QSDDEEETEVAVNVDGHDSYMDDFFAQVEEIRGMIDKVQDNVEEVKKKHSAILSAPQTDEKTKQE 77
            |.:.:|..:.|| :...:..:|.:..::::::..|.::.|:|.:..::...::|..:.....|:|
 Frog    28 QKEPDELQQQAV-IFEREPVLDSYLHEIQKLKNDIAELSDSVTKFGQEQKVLVSNMRRFSVMKRE 91

  Fly    78 LEDLMADIKKNANRVRGKLKGIEQNIEQ-EEQQNKSSADLRIRKTQHSTLSRKFVEVMTEYNRTQ 141
             :::...|:..|..::.:|..:.|..:: |.:|..:|..:||.|.|||.|.|||..:|.:||.|.
 Frog    92 -DNITKVIRVQAENIKKRLDSLSQVAKKVEAEQGPTSGVVRIIKGQHSALFRKFQNIMLQYNDTI 155

  Fly   142 TDYRERCKGRIQRQLEITGRPTNDDELEKMLEEGNSSVFTQGIIMETQQAKQTLADIEARHQDIM 206
            ...:.:||..|.||||:.|:..:::|:.||:|:|...||.:.::.|.:..:..|.:||.||::::
 Frog   156 AAKQSKCKTFIIRQLEVAGKEVSEEEVNKMMEQGKWDVFNENLLTEVKITRSQLTEIEQRHKELV 220

  Fly   207 KLETSIKELHDMFMDMAMLVESQGEMIDRIEYHVEHAMDYVQTATQDTKKALKYQSK 263
            .||..:|:|.|:|:.:::|||.|||||:.||...::..:|||..|:..|.|:||:.|
 Frog   221 SLENQMKDLKDIFLQISLLVEEQGEMINNIEVSTQNTENYVQQTTEKFKLAVKYKRK 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx1ANP_001189276.1 Syntaxin 33..230 CDD:395647 58/197 (29%)
SNARE 231..281 CDD:399038 14/33 (42%)
stx19NP_001016670.1 Syntaxin 47..244 CDD:366315 58/197 (29%)
SNARE 212..278 CDD:389950 29/66 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1033833at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.