DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx1A and stx3

DIOPT Version :9

Sequence 1:NP_001189276.1 Gene:Syx1A / 42854 FlyBaseID:FBgn0013343 Length:296 Species:Drosophila melanogaster
Sequence 2:XP_031760934.1 Gene:stx3 / 549026 XenbaseID:XB-GENE-5825360 Length:326 Species:Xenopus tropicalis


Alignment Length:318 Identity:163/318 - (51%)
Similarity:226/318 - (71%) Gaps:42/318 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDRLAALHAAQSDDEEETEVAVNVDGHDSYMDDFFAQVEEIRGMIDKVQDNVEEVKKKHSAILSA 67
            ||||..|.|.:..|::: ||.:::| :.::|||||:|:||||..|:|:.:.|.|.|:.||.||||
 Frog     2 KDRLDQLKATRDTDDQD-EVDISID-NAAFMDDFFSQIEEIRQNIEKIAECVNETKRLHSVILSA 64

  Fly    68 PQTDEKTKQELEDLMADIKKNANRVRGKLKGIEQNIEQEEQQNKSSADLRIRKTQHSTLSRKFVE 132
            |..::|||.|||:|..:|||.||.||.:||.:||:|||::.|  ||.||||||:|||.||||||:
 Frog    65 PLPEQKTKDELENLTMEIKKTANSVRSRLKTMEQSIEQDDMQ--SSTDLRIRKSQHSVLSRKFVD 127

  Fly   133 VMTEYNRTQTDYRERCKGRIQRQLEITGRPTNDDELEKMLEEGNSSVFTQGIIMETQQAKQTLAD 197
            |||:||..|.|:|||.||||||||||||:.|.|:|||:|||.||.::||.|||.::|.::|.|::
 Frog   128 VMTKYNEAQVDFRERSKGRIQRQLEITGKSTTDEELEEMLESGNPNIFTSGIINDSQISRQALSE 192

  Fly   198 IEARHQDIMKLETSIKELHDMFMDMAMLVESQGE------------------------------- 231
            ||:||:||::||:|:|||||||||:|||||:|||                               
 Frog   193 IESRHRDIVRLESSLKELHDMFMDIAMLVENQGESLDNIELNVMKSVEHVEKAREETTKAVKYQN 257

  Fly   232 ------MIDRIEYHVEHAMDYVQTATQDTKKALKYQSKARRKKIMI-LICLTVLGILA 282
                  :|||||.:::.::.:|:.|..|||||:||||:||||.|:| ::...:|||:|
 Frog   258 KARKGTLIDRIENNMDESVGFVERAVADTKKAVKYQSEARRKIIIIGVVVAVLLGIVA 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx1ANP_001189276.1 Syntaxin 33..230 CDD:395647 124/196 (63%)
SNARE 231..281 CDD:399038 25/87 (29%)
stx3XP_031760934.1 Syntaxin 30..225 CDD:395647 124/196 (63%)
SNARE 193..259 CDD:419871 26/65 (40%)
SNARE 263..>299 CDD:399038 18/35 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1033833at2759
OrthoFinder 1 1.000 - - FOG0000185
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.