DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx1A and stx11

DIOPT Version :9

Sequence 1:NP_001189276.1 Gene:Syx1A / 42854 FlyBaseID:FBgn0013343 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001008147.1 Gene:stx11 / 493509 XenbaseID:XB-GENE-952014 Length:285 Species:Xenopus tropicalis


Alignment Length:269 Identity:88/269 - (32%)
Similarity:155/269 - (57%) Gaps:8/269 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDRL------AALHAAQSDDEEETEV-AVNVDGHDSYMDDFFAQVEEIRGMIDKVQDNVEEVKKK 60
            ||||      |.||......|||.|: ...|...|..::..:..::.||.....::.:|:.:.|:
 Frog     2 KDRLNELLEYAKLHTQYVQGEEEDELQGFGVFDTDHALESLYQDIQLIRTENHLMKVDVKRLGKQ 66

  Fly    61 HSAILSAPQTDEKTKQELEDLMADIKKNANRVRGKLKGIEQNIEQ-EEQQNKSSADLRIRKTQHS 124
            .:..|::.:.....|::...:..|||..|..:..||:.::...|. |.:..:||...|:.|:|:.
 Frog    67 TTRFLTSMRRLSSIKRDSNSIAKDIKTRAEGIHKKLQSLKNLSEDAENKSGESSVMARVSKSQYM 131

  Fly   125 TLSRKFVEVMTEYNRTQTDYRERCKGRIQRQLEITGRPTNDDELEKMLEEGNSSVFTQGIIMETQ 189
            ||:.:|.|.|.|||..:...||.||.||||||||.|:..:.::::.|:|:|...||::.::.:.:
 Frog   132 TLTLEFQEAMLEYNEAEMVQRENCKIRIQRQLEIMGKDVSGNQIDDMIEQGKWDVFSENLLSDVK 196

  Fly   190 QAKQTLADIEARHQDIMKLETSIKELHDMFMDMAMLVESQGEMIDRIEYHVEHAMDYVQTATQDT 254
            .|:..|.:||.||::::|||:.|:|:||:|:.||:|||.|.|.::.:|.::|...|||..|....
 Frog   197 VARSALNEIETRHKELLKLESRIREVHDLFLQMAILVEEQAETLNVVELNMEKVKDYVGEAKTQV 261

  Fly   255 KKALKYQSK 263
            ::|::|:.|
 Frog   262 RQAVEYKRK 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx1ANP_001189276.1 Syntaxin 33..230 CDD:395647 64/197 (32%)
SNARE 231..281 CDD:399038 10/33 (30%)
stx11NP_001008147.1 Syntaxin 39..236 CDD:395647 64/196 (33%)
SNARE 205..270 CDD:419871 27/64 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1033833at2759
OrthoFinder 1 1.000 - - FOG0000185
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.