DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx1A and stx11a

DIOPT Version :9

Sequence 1:NP_001189276.1 Gene:Syx1A / 42854 FlyBaseID:FBgn0013343 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_998075.1 Gene:stx11a / 405846 ZFINID:ZDB-GENE-040426-2564 Length:294 Species:Danio rerio


Alignment Length:281 Identity:88/281 - (31%)
Similarity:156/281 - (55%) Gaps:24/281 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDRLAALHAAQS----------------DDEEETEVAVNVDGHDSYMDDFFAQVEEIRGMIDKVQ 51
            :|||..|....:                |::|..:.||..:|.| .|:|.|.:.:.|:..|.:::
Zfish     2 RDRLVELEGIATKIIKEEEDQADSGDDVDNDEFEQHAVVFEGED-IMEDAFKKAQSIQKEIAQLR 65

  Fly    52 DNVEEVKKKHSAILSAPQTDEKTKQELEDLMADIKKNAN----RVRGKLKGIEQNIEQEEQQNKS 112
            ..|:.:.|:::..|::.:.....|::...:...||....    |:: ||.|:.:  |.||:|...
Zfish    66 MEVKRLGKQNTRFLTSVRRISSIKRDSNTIARSIKTKGESLYARIQ-KLDGLCK--ELEEKQGAH 127

  Fly   113 SADLRIRKTQHSTLSRKFVEVMTEYNRTQTDYRERCKGRIQRQLEITGRPTNDDELEKMLEEGNS 177
            ||.:|:.:.|..:::..|.|.|.|||..:...|:.|..|||||.||.|:...:|::|:|:|.|..
Zfish   128 SALVRMIRGQFISITGAFHEAMNEYNAAEMAQRDNCMTRIQRQAEIVGKEVTEDQIEEMIETGKW 192

  Fly   178 SVFTQGIIMETQQAKQTLADIEARHQDIMKLETSIKELHDMFMDMAMLVESQGEMIDRIEYHVEH 242
            :||:..::.:.:.|:..|.:||.||:::::||:.|:::.::|..:|:|||.||.|:|.||.:|..
Zfish   193 NVFSDDLLTDGRTARSALTEIENRHKELLELESRIRDIRELFFQLALLVEEQGPMVDNIEANVYA 257

  Fly   243 AMDYVQTATQDTKKALKYQSK 263
            ..|||..||...|||:||:.|
Zfish   258 TQDYVAKATTQIKKAVKYKKK 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx1ANP_001189276.1 Syntaxin 33..230 CDD:395647 60/200 (30%)
SNARE 231..281 CDD:399038 16/33 (48%)
stx11aNP_998075.1 Syntaxin 47..245 CDD:279182 60/200 (30%)
SynN 47..199 CDD:238105 46/154 (30%)
SNARE 209..269 CDD:304603 25/59 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5074
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1033833at2759
OrthoFinder 1 1.000 - - FOG0000185
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.