DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx1A and Syx6

DIOPT Version :9

Sequence 1:NP_001189276.1 Gene:Syx1A / 42854 FlyBaseID:FBgn0013343 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_995816.1 Gene:Syx6 / 40373 FlyBaseID:FBgn0037084 Length:339 Species:Drosophila melanogaster


Alignment Length:329 Identity:59/329 - (17%)
Similarity:111/329 - (33%) Gaps:90/329 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DFFAQVEEIRGMIDKVQDNVE----EVKKKHSAILSAPQTDEKTKQELEDLMADIKKNA------ 89
            :.|..:.:.||:..:.::..|    |.:...:.:.::.::.|...::|||.::.::||.      
  Fly    29 EVFKALNKTRGLYLRWRELGENGGTEAEWTTTELRNSLRSIEWDLEDLEDTISIVEKNPSKFRID 93

  Fly    90 NRVRGKLKGIEQNIEQEEQQNKSSADLRIRKTQHSTLSRKFVE------------VMTEYNRTQT 142
            ||.....:....|...|.:|.|....|...:.:..|..:..::            .:...|....
  Fly    94 NRELSSRRHFIDNTRDEVKQMKDKMSLNRSRDRDITAHQPLLDNDRHSPNHNHSIAIPNSNSNSN 158

  Fly   143 DYRERCKGRIQRQLEITGRPTNDDELEKMLEEGNSSVFTQGIIMETQQAKQTLADIEA-RHQ--D 204
            :|.:              .|.||.........|||.:.:...:..|.....:.|...| ||.  .
  Fly   159 EYHQ--------------HPHNDRTYLVECPNGNSLINSGSQVANTIAGTMSAAAAAASRHSGTK 209

  Fly   205 IMKLETSIK------ELHDMFMD-------------MAMLVESQGEMIDRIEYHV---------- 240
            ..|||.::.      :.|...||             ...:::.|.|.:|.|...:          
  Fly   210 YSKLENALDSPSHYGQTHHGGMDSPSHRYVGETVSIQQRMIQGQDEQLDMISDSIGTLKTVSRQI 274

  Fly   241 -----EHAM---------DYVQTATQDT-KKALK--YQSKARRKKIMILICLTVLGILAASYVSS 288
                 |.|:         |..::....| ||..|  :.:..:|:...|||   :.|:|.  :|..
  Fly   275 GVELDEQAVMLDDFGNEFDTTESKLDTTMKKVAKVLHMNNDKRQWAAILI---LSGLLL--FVII 334

  Fly   289 YFII 292
            .|||
  Fly   335 LFII 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx1ANP_001189276.1 Syntaxin 33..230 CDD:395647 38/238 (16%)
SNARE 231..281 CDD:399038 15/76 (20%)
Syx6NP_995816.1 Syntaxin-6_N 29..115 CDD:286286 16/85 (19%)
SNARE_Syntaxin6 250..315 CDD:277204 11/64 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.