DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx1A and Syx13

DIOPT Version :9

Sequence 1:NP_001189276.1 Gene:Syx1A / 42854 FlyBaseID:FBgn0013343 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001261794.1 Gene:Syx13 / 39485 FlyBaseID:FBgn0036341 Length:284 Species:Drosophila melanogaster


Alignment Length:280 Identity:50/280 - (17%)
Similarity:120/280 - (42%) Gaps:25/280 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 HAAQSDDEEETEVAVNVDGHDSYMDDFFAQVEEIRGMIDKVQDNVEEVKKKHSAILSAPQTDEKT 74
            :.|.:|...|...|...........:|.:..|:|...|..:..:.::::|:...|        .|
  Fly    21 YGAMADSTPEVSFAAAGGSSGFSPTEFMSLSEDIGHNITAIHSSTKQLEKQLKLI--------GT 77

  Fly    75 KQELEDLMADIKKNANRVRGKLKGIEQNIEQEEQQNKS---SADLRIRKTQHSTLSRKFVEVMTE 136
            .:|    ..::::..:.:..|.....|...|:.|:.::   ..| |.:|.|...|:|:|..|:.:
  Fly    78 SKE----QPNLREKVHTINTKCNARVQTTSQDLQRLQAVVRHGD-RQQKLQLEKLTREFHGVVEK 137

  Fly   137 YNRTQTDYRERCKGRIQRQLEITGRPTNDDELEKMLEEGNSSVFTQGIIMETQQAKQTLADIEAR 201
            |:..|.......:..:|:..:...:....:...::|::..         :|....:|....::.|
  Fly   138 YSNLQRRISSAMRQTLQQAQQFADQVVETNARAELLQQQR---------LEQAHLQQEHDMLDDR 193

  Fly   202 HQDIMKLETSIKELHDMFMDMAMLVESQGEMIDRIEYHVEHAMDYVQTATQDTKKALKYQSKARR 266
            .:.:.::|:.|.:::.:...::.||..||:.:|.||..:|.....|:..|.:..||.:.:...||
  Fly   194 RRQVEQIESDIIDVNQIMTQLSGLVHDQGQQMDFIENSIEQTAANVEDGTSELAKAARSRQSYRR 258

  Fly   267 KKIMILICLTVLGILAASYV 286
            |.:::|:...::|::....:
  Fly   259 KILILLVIAVIIGLIVTGVI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx1ANP_001189276.1 Syntaxin 33..230 CDD:395647 31/199 (16%)
SNARE 231..281 CDD:399038 13/49 (27%)
Syx13NP_001261794.1 Syntaxin_2 54..153 CDD:291208 20/111 (18%)
SNARE_syntaxin7_like 190..249 CDD:277200 13/58 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467313
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.